KEGG   Escherichia coli K-12 MG1655: b0678Help
Entry
b0678             CDS       T00007                                 

Gene name
nagB
Definition
(RefSeq) glucosamine-6-phosphate deaminase (EC:3.5.99.6)
  KO
K02564  
glucosamine-6-phosphate deaminase [EC:3.5.99.6]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    b0678 (nagB)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.6  glucosamine-6-phosphate deaminase
     b0678 (nagB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(702811..703611)
Genome map
AA seq 266 aa AA seqDB search
MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQ
VSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQ
YEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQ
VPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCD
EPSTMELKVKTLRYFNELEAENIKGL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagactgatccccctgactaccgctgaacaggtcggcaaatgggctgctcgccatatc
gtcaatcgtatcaatgcgttcaaaccgactgccgatcgtccgtttgtactgggcctgccg
actggcggcacgccgatgaccacctataaagcgttagtcgaaatgcataaagcaggccag
gtcagctttaagcacgttgtcaccttcaacatggacgaatatgtcggtctgccgaaagag
catccggaaagctactacagctttatgcaccgtaatttcttcgatcacgttgatattcca
gcagaaaacatcaaccttctcaacggcaacgccccggatatcgacgccgagtgccgccag
tatgaagaaaaaatccgttcttacggaaaaattcatctgtttatgggcggtgtaggtaac
gacggtcatattgcatttaacgaaccggcgtcttctctggcttctcgtactcgtatcaaa
accctgactcatgacactcgcgtcgcaaactctcgtttctttgataacgatgttaatcag
gtgccaaaatatgccctgactgtcggtgttggtacactgctggatgccgaagaagtgatg
attctggtgctgggtagccagaaagcactggcgctgcaggccgccgttgaaggttgcgtg
aaccatatgtggaccatcagctgtctgcaactgcatccgaaagcgatcatggtgtgcgat
gaaccttccaccatggagctgaaagttaagactttaagatatttcaatgaattagaagca
gaaaatatcaaaggtctgtaa

DBGET integrated database retrieval system