KEGG   Escherichia coli K-12 MG1655: b0684Help
Entry
b0684             CDS       T00007                                 

Gene name
fldA
Definition
(RefSeq) flavodoxin 1
  KO
K03839  
flavodoxin I
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(710935..711465)
Genome map
AA seq 176 aa AA seqDB search
MAITGIFFGSDTGNTENIAKMIQKQLGKDVADVHDIAKSSKEDLEAYDILLLGIPTWYYG
EAQCDWDDFFPTLEEIDFNGKLVALFGCGDQEDYAEYFCDALGTIRDIIEPRGATIVGHW
PTAGYHFEASKGLADDDHFVGLAIDEDRQPELTAERVEKWVKQISEELHLDEILNA
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggctatcactggcatctttttcggcagcgacaccggtaataccgaaaatatcgcaaaa
atgattcaaaaacagcttggtaaagacgttgccgatgtccatgacattgcaaaaagcagc
aaagaagatctggaagcttatgacattctgctgctgggcatcccaacctggtattacggc
gaagcgcagtgtgactgggatgacttcttcccgactctcgaagagattgatttcaacggc
aaactggttgcgctgtttggttgtggtgaccaggaagattacgccgaatatttctgcgac
gcattgggcaccatccgcgacatcattgaaccgcgcggtgcaaccatcgttggtcactgg
ccaactgcgggctatcatttcgaagcatcaaaaggtctggcagatgacgaccactttgtc
ggtctggctatcgacgaagaccgtcagccggaactgaccgctgaacgtgtagaaaaatgg
gttaaacagatttctgaagagttgcatctcgacgaaattctcaatgcctga

DBGET integrated database retrieval system