KEGG   Escherichia coli K-12 MG1655: b0697Help
Entry
b0697             CDS       T00007                                 

Gene name
kdpB
Definition
(RefSeq) potassium translocating ATPase, subunit B (EC:3.6.3.12)
  KO
K01547  
K+-transporting ATPase ATPase B chain [EC:3.6.3.12]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b0697 (kdpB)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.12  K+-transporting ATPase
     b0697 (kdpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(724988..727036)
Genome map
AA seq 682 aa AA seqDB search
MSRKQLALFEPTLVVQALKEAVKKLNPQAQWRNPVMFIVWIGSLLTTCISIAMASGAMPG
NALFSAAISGWLWITVLFANFAEALAEGRSKAQANSLKGVKKTAFARKLREPKYGAAADK
VPADQLRKGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGGDFASVTGGT
RILSDWLVIECSVNPGETFLDRMIAMVEGAQRRKTPNEIALTILLIALTIVFLLATATLW
PFSAWGGNAVSVTVLVALLVCLIPTTIGGLLSAIGVAGMSRMLGANVIATSGRAVEAAGD
VDVLLLDKTGTITLGNRQASEFIPAQGVDEKTLADAAQLASLADETPEGRSIVILAKQRF
NLRERDVQSLHATFVPFTAQSRMSGINIDNRMIRKGSVDAIRRHVEANGGHFPTDVDQKV
DQVARQGATPLVVVEGSRVLGVIALKDIVKGGIKERFAQLRKMGIKTVMITGDNRLTAAA
IAAEAGVDDFLAEATPEAKLALIRQYQAEGRLVAMTGDGTNDAPALAQADVAVAMNSGTQ
AAKEAGNMVDLDSNPTKLIEVVHIGKQMLMTRGSLTTFSIANDVAKYFAIIPAAFAATYP
QLNALNIMCLHSPDSAILSAVIFNALIIVFLIPLALKGVSYKPLTASAMLRRNLWIYGLG
GLLVPFIGIKVIDLLLTVCGLV
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtaaacaactggcgctattcgaaccaacacttgtcgttcaggcgctgaaagaa
gcggtgaaaaaattaaacccgcaggcgcaatggcgcaatccggtgatgtttatcgtctgg
atcggcagtctgctgaccacctgtattagcatcgcgatggcaagcggtgcgatgcccggc
aatgcgctgtttagcgcggccattagcggttggctgtggatcaccgtactgttcgctaat
ttcgccgaggcgctggcagaaggccgcagtaaagcgcaggccaacagtctgaaaggggtg
aaaaaaactgcctttgcccgcaagctgcgtgagccgaaatatggcgctgcggcggacaaa
gttcctgccgaccaacttcgtaaaggcgatatcgtactggtagaagctggcgatattatc
ccctgcgatggtgaagttattgaagggggtgcatcggtcgatgaaagcgccatcaccggg
gaatcggcaccggtgatccgtgaatccggcggcgattttgcctccgtcaccggcggcacg
cgtattctttctgactggctggtgattgagtgtagcgttaaccccggcgagacatttctg
gatcggatgatcgcgatggtggaaggcgcacagcgacgcaaaacgccgaacgaaattgcc
ctgaccattctgctgattgccctgactatcgtctttttactggcaaccgccacgctgtgg
ccgttttccgcgtggggcggtaatgcagtcagcgtaacggtactggtggcgctgctggtc
tgtctgatcccaaccactattggcggcctgttgtcagcgatcggcgtcgccgggatgagc
cggatgctaggcgcgaatgtgattgccaccagcggacgtgcagttgaagcggcaggtgac
gttgacgttctgctactggataaaaccggcaccatcacactcggtaaccgtcaggcgtcg
gagtttatccccgcgcagggcgtggatgaaaaaacgctggctgacgccgcacaactggct
tcgctggctgatgaaacgccggaaggccgcagtattgtgatcctcgccaagcagcgtttt
aacctgcgcgagcgcgatgtgcagtcgctccatgccacctttgtaccgtttactgcgcaa
agccggatgagcgggatcaacatcgacaaccgcatgatccgtaaaggttctgtcgatgcc
attcgtcgccatgttgaggctaacggtggtcacttccctaccgatgttgatcaaaaagtc
gatcaggttgcgcgtcagggagccacgccgctggtggtggtggaaggttctcgtgtgctg
ggcgttattgcgctgaaagatatcgtcaaaggcggtattaaagagcgcttcgcccagctg
cgcaaaatgggcattaaaacggtgatgattaccggcgataaccgtctgactgccgccgcg
attgctgcggaagcgggtgtcgatgattttctcgccgaagcgacaccggaggccaagctg
gcattgatccgtcagtatcaggcggaaggtcgtttggtagcgatgaccggcgacggcacc
aacgatgctccggcgctggcgcaggcagatgtcgcggtggcgatgaactccggcacccag
gcggcgaaagaggcgggcaatatggtcgatctcgactctaacccgaccaagttgatcgag
gtggtgcacattggcaaacagatgctgatgacccgtggctcgctgaccaccttcagcatt
gccaacgatgtggcgaaatacttcgccattattccggcggcattcgcggcaacgtatccg
cagttaaatgcgctgaacatcatgtgcctgcattcgcccgactccgcaatcctcagtgcg
gtgattttcaacgccttgattatcgtctttttgattcccctggcgttaaaaggcgtgagt
tataaaccgcttaccgcttctgccatgttgcgccgtaacttatggatttacggtctgggt
gggctgctggtgccgtttatcggtatcaaagtcattgatttactgctgaccgtttgcggt
ctggtgtga

DBGET integrated database retrieval system