KEGG   Escherichia coli K-12 MG1655: b0709Help
Entry
b0709             CDS       T00007                                 

Gene name
dtpD
Definition
(RefSeq) dipeptide and tripeptide permease D
  KO
K03305  
proton-dependent oligopeptide transporter, POT family
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(741075..742556)
Genome map
AA seq 493 aa AA seqDB search
MNKHASQPRAIYYVVALQIWEYFSFYGMRALLILYLTNQLKYNDTHAYELFSAYCSLVYV
TPILGGFLADKVLGNRMAVMLGALLMAIGHVVLGASEIHPSFLYLSLAIIVCGYGLFKSN
VSCLLGELYEPTDPRRDGGFSLMYAAGNVGSIIAPIACGYAQEEYSWAMGFGLAAVGMIA
GLVIFLCGNRHFTHTRGVNKKVLRATNFLLPNWGWLLVLLVATPALITILFWKEWSVYAL
IVATIIGLGVLAKIYRKAENQKQRKELGLIVTLTFFSMLFWAFAQQGGSSISLYIDRFVN
RDMFGYTVPTAMFQSINAFAVMLCGVFLAWVVKESVAGNRTVRIWGKFALGLGLMSAGFC
ILTLSARWSAMYGHSSLPLMVLGLAVMGFAELFIDPVAMSQITRIEIPGVTGVLTGIYML
LSGAIANYLAGVIADQTSQASFDASGAINYSINAYIEVFDQITWGALACVGLVLMIWLYQ
ALKFRNRALALES
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacacgcatcacagccgcgcgctatttactatgtcgttgcgctgcaaatctgg
gaatattttagcttttacggcatgcgtgccctgctgattctctatctcaccaatcaacta
aaatacaacgatactcacgcctacgagttatttagcgcctactgttcgctggtgtatgtc
acgccaatcctcggtggctttttggcggataaagttctcggcaatcgcatggcggtgatg
ctgggggcgttgttgatggcgatcggtcatgtggtgctgggtgccagtgagatccatccg
tcattcctctatctgtccctggcgattatcgtctgcggctatggcctgtttaaatctaac
gtaagctgtctgctcggcgagctgtatgagccaaccgatccgcgtcgtgatggcggtttc
tcgctgatgtatgcggcgggtaacgtggggtctattatcgcacctatcgcctgtggttac
gcccaggaagagtacagctgggcgatgggctttggcctggcggcggttggcatgatcgcg
ggtctggtcattttcttatgtggcaatcgtcatttcactcatacccgcggcgttaacaaa
aaagtactgcgtgcgacaaactttctcctgccgaactggggatggctgctggttctgctg
gtggcaacgcctgcactgattaccatactgttctggaaagagtggtcggtatacgcctta
attgtcgcgactattattggcctgggtgtactggcaaaaatttatcgcaaagcagaaaac
cagaaacagcggaaggagctggggctgattgtgacgctcaccttcttcagtatgttgttc
tgggccttcgcacaacagggcggtagctcgattagcctttatatcgaccgcttcgttaac
cgcgatatgtttggttataccgttccgaccgcgatgttccagtcgattaatgccttcgca
gttatgctgtgcggtgtgttcctggcgtgggtggtaaaagagagtgtcgcgggtaatcgt
accgtgcgcatctgggggaaatttgctcttggccttggcctgatgagcgccggattctgc
attctgaccttaagcgcccgctggtccgcaatgtatggtcactcttctctgccactgatg
gtattaggcctggcggtgatgggctttgcggaactgtttatcgacccggttgccatgtcg
caaattacgcgcattgaaatccccggtgtgaccggcgtattaaccggcatctacatgctg
ctttctggcgcgatcgcgaactatctggcgggcgtgattgccgatcagacatcgcaggct
tcgtttgatgcttccggggcgatcaactactccatcaatgcatatattgaagtatttgat
caaattacctggggcgcactggcgtgtgtaggactggtactgatgatttggctgtatcag
gcgctgaaattcagaaaccgcgcgctggcgctggagtcttaa

DBGET integrated database retrieval system