KEGG   Escherichia coli K-12 MG1655: b0715Help
Entry
b0715             CDS       T00007                                 

Gene name
abrB
Definition
(RefSeq) regulator of aidB expression; inner membrane protein
  KO
K07120  
uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(746723..747769)
Genome map
AA seq 348 aa AA seqDB search
MPVLQWGMLCVLSLLLSIGFLAVHLPAALLLGPMIAGIIFSMRGITLQLPRSAFLAAQAI
LGCMIAQNLTGSILTTLAVNWPIVLAILLVTLLSSAIVGWLLVRYSSLPGNTGAWGSSPG
GAAAMVAMAQDYGADIRLVAFMQYLRVLFVAGAAVLVTRMMLGDNAEAVNQHIVWFPPVS
INLLLTILLAVVAGTVGCLLRLPSGTMLIPMLAGAVLQSGQLITIELPEWLLAMAYMAIG
WRIGLGFDKQILLRALRPLPQILLSIFALLAICAGMAWGLTRFMHIDFMTAYLATSPGGL
DTVAVIAAGSNADMALIMAMQTLRLFSILLTGPAIARFISTYAPKRSA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgccagttttgcagtggggaatgttatgtgtgctatcacttctcctttctattggtttc
ctcgcggtacatctcccggcggcgctattacttgggccgatgatcgccgggatcatcttt
agtatgcgcggaattactctgcaacttccccgctctgcttttctcgccgcccaggccatt
cttggctgcatgattgcgcaaaacctcactggttcgattctcaccaccctggccgtcaac
tggccgatcgtgcttgcaattttactggtaacgctgctttccagcgccattgtgggttgg
ttattggtgcgctatagctcattgcctggaaataccggtgcctggggctcctctcctggc
ggcgcggcggcaatggtcgctatggcgcaagattacggcgcagatattcgcctggtggcg
tttatgcaatatctgcgagtgctgttcgtcgcgggggccgctgttctggtcacccgcatg
atgctgggcgataacgctgaagcggttaaccagcatatcgtctggttcccgccagtgagc
attaatctcctgcttactattttgctcgcggtcgttgccggtacagtgggatgcctgctg
cgtcttccttccggcacgatgctcatcccgatgctggcgggcgcagtgctccagtctggt
cagctcatcaccatcgaactaccggaatggctgctggcgatggcgtatatggcaattggc
tggcggattggtcttggtttcgataaacaaatcttactgcgggcactacgcccgctaccg
caaatcctgctgtcgatttttgctctgctggctatttgtgcgggtatggcgtgggggctg
acccggtttatgcacattgattttatgactgcctacctcgccaccagccccggcgggctt
gataccgtggcggtcatcgccgcagggagcaatgccgatatggcgctcattatggcgatg
caaaccctacgcctgttcagtattttgctgacagggcctgccattgcgcggtttatttca
acctatgcgccgaagcggtcggcctag

DBGET integrated database retrieval system