KEGG   Escherichia coli K-12 MG1655: b0723Help
Entry
b0723             CDS       T00007                                 

Gene name
sdhA
Definition
(RefSeq) succinate dehydrogenase, flavoprotein subunit (EC:1.3.99.1)
  KO
K00239  
succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    b0723 (sdhA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    b0723 (sdhA)
   00650 Butanoate metabolism
    b0723 (sdhA)
  Energy metabolism
   00190 Oxidative phosphorylation
    b0723 (sdhA)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     b0723 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     b0723 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
755907..757673
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEKGEDVVVPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGALRDASESDVEASLDRLNRWNNNRNGEDPVAIRKALQECMQHNFSVFREGDAM
AKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgccagtcagagaatttgatgcagttgtgattggtgccggtggcgcaggtatg
cgcgcggcgctgcaaatttcccagagcggccagacctgtgcgctgctctctaaagtcttc
ccgacccgttcccataccgtttctgcgcaaggcggcattaccgttgcgctgggtaatacc
catgaagataactgggaatggcatatgtacgacaccgtgaaagggtcggactatatcggt
gaccaggacgcgattgaatatatgtgtaaaaccgggccggaagcgattctggaactcgaa
cacatgggcctgccgttctcgcgtctcgatgatggtcgtatctatcaacgtccgtttggc
ggtcagtcgaaaaacttcggcggcgagcaggcggcacgcactgcggcagcagctgaccgt
accggtcacgcactgttgcacacgctttatcagcagaacctgaaaaaccacaccaccatt
ttctccgagtggtatgcgctggatctggtgaaaaaccaggatggcgcggtggtgggttgt
accgcactgtgcatcgaaaccggtgaagtggtttatttcaaagcccgcgctaccgtgctg
gcgactggcggagcagggcgtatttatcagtccaccaccaacgcccacattaacaccggc
gacggtgtcggcatggctatccgtgccggcgtaccggtgcaggatatggaaatgtggcag
ttccacccgaccggcattgccggtgcgggcgtactggtcaccgaaggttgccgtggtgaa
ggcggttatctgctgaacaaacatggcgaacgttttatggagcgttatgcgccgaacgcc
aaagacctggcgggccgtgacgtggttgcgcgttccatcatgatcgaaatccgtgaaggt
cgcggctgtgatggtccgtgggggccacacgcgaaactgaaactcgatcacctgggtaaa
gaagttctcgaatcccgtctgccgggtatcctggagctttcccgtaccttcgctcacgtc
gatccggtgaaagagccgattccggttatcccaacctgtcactacatgatgggcggtatt
ccgaccaaagttaccggtcaggcactgactgtgaatgagaaaggcgaagatgtggttgtt
ccgggactgtttgccgttggtgaaatcgcttgtgtatcggtacacggcgctaaccgtctg
ggcggcaactcgctgctggacctggtggtctttggtcgcgcggcaggtctgcatctgcaa
gagtctatcgccgagcagggcgcactgcgcgatgccagcgagtctgatgttgaagcgtct
ctggatcgcctgaaccgctggaacaataatcgtaacggtgaagatccggtggcgatccgt
aaagcgctgcaagaatgtatgcagcataacttctcggtcttccgtgaaggtgatgcgatg
gcgaaagggcttgagcagttgaaagtgatccgcgagcgtctgaaaaatgcccgtctggat
gacacttccagcgagttcaacacccagcgcgttgagtgcctggaactggataacctgatg
gaaacggcgtatgcaacggctgtttctgccaacttccgtaccgaaagccgtggcgcgcat
agccgcttcgacttcccggatcgtgatgatgaaaactggctgtgccactccctgtatctg
ccagagtcggaatccatgacgcgccgaagcgtcaacatggaaccgaaactgcgcccggca
ttcccgccgaagattcgtacttactaa

DBGET integrated database retrieval system