KEGG   Escherichia coli K-12 MG1655: b0734Help
Entry
b0734             CDS       T00007                                 

Gene name
cydB
Definition
(RefSeq) cytochrome d terminal oxidase, subunit II
  KO
K00426  cytochrome bd ubiquinol oxidase subunit II [EC:1.10.3.14]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00190  Oxidative phosphorylation
eco01100  Metabolic pathways
eco02020  Two-component system
Module
eco_M00153  Cytochrome bd ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    b0734 (cydB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b0734 (cydB)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.14  ubiquinol oxidase (electrogenic, non H+-transporting)
     b0734 (cydB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyt_bd_oxida_II
Motif
Other DBs
NCBI-GeneID: 945347
NCBI-ProteinID: NP_415262
Pasteur: cydB
RegulonDB: ECK120000169
ECOCYC: EG10174
ASAP: ABE-0002501
UniProt: P0ABK2
Position
773042..774181
Genome map
AA seq 379 aa AA seqDB search
MIDYEVLRFIWWLLVGVLLIGFAVTDGFDMGVGMLTRFLGRNDTERRIMINSIAPHWDGN
QVWLITAGGALFAAWPMVYAAAFSGFYVAMILVLASLFFRPVGFDYRSKIEETRWRNMWD
WGIFIGSFVPPLVIGVAFGNLLQGVPFNVDEYLRLYYTGNFFQLLNPFGLLAGVVSVGMI
ITQGATYLQMRTVGELHLRTRATAQVAALVTLVCFALAGVWVMYGIDGYVVKSTMDHYAA
SNPLNKEVVREAGAWLVNFNNTPILWAIPALGVVLPLLTILTARMDKAAWAFVFSSLTLA
CIILTAGIAMFPFVMPSSTMMNASLTMWDATSSQLTLNVMTWVAVVLVPIILLYTAWCYW
KMFGRITKEDIERNTHSLY
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgatcgattatgaagtattgcgttttatctggtggctgctggttggcgttctgctgatt
ggttttgcagtcactgacggtttcgacatgggggtgggcatgctcacccgtttcctcggt
cgtaacgacaccgagcgtcgaattatgattaactccattgcaccacactgggacggtaac
caggtttggctgatcaccgcgggcggcgcactctttgctgcctggccgatggtctatgcc
gctgcgttctccggcttctatgtggcgatgatcctcgtgctggcgtctttgttcttccgt
ccggtcggttttgactaccgctccaagattgaagaaacccgctggcgtaacatgtgggac
tggggcatcttcattggtagcttcgttccgccgctggtaattggtgtagcgttcggtaac
ctgttgcagggcgtaccgttcaacgttgatgaatatctgcgtctgtactacaccggtaac
ttcttccagttgcttaacccgttcggcctgctggcaggcgtggtgagcgtagggatgatc
attactcagggcgcaacctatctgcaaatgcgtaccgtgggcgaactgcacctgcgtacc
cgtgcaacggctcaggtggctgcgctggtgacactggtctgtttcgcactggctggcgta
tgggtgatgtacggtatcgatggttatgtcgtgaaatcgacaatggaccattacgcagcc
tctaacccactgaataaagaagtggttcgtgaagctggcgcatggctggttaacttcaac
aacacgccaattctgtgggctattccggcactgggtgtggttctgccgctgctgaccatc
ctgactgcacgtatggataaagccgcgtgggcgtttgtgttctcctccctgacgctggcc
tgcatcatcctgacagccggtatcgcaatgttcccgtttgtgatgccgtccagcaccatg
atgaacgcaagtctgacaatgtgggatgcaacttccagccagctgacgcttaacgtcatg
acctgggttgcggtggttctggtaccgatcattctgctctacaccgcctggtgttactgg
aaaatgttcggtcgtatcaccaaagaagatattgaacgtaacacccactctctgtactaa

DBGET integrated database retrieval system