KEGG   Escherichia coli K-12 MG1655: b0739Help
Entry
b0739             CDS       T00007                                 

Gene name
tolA
Definition
(RefSeq) membrane anchored protein in TolA-TolQ-TolR complex
  KO
K03646  
colicin import membrane protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b0739 (tolA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
776342..777607
Genome map
AA seq 421 aa AA seqDB search
MSKATEQNDKLKRAIIISAVLHVILFAALIWSSFDENIEASAGGGGGSSIDAVMVDSGAV
VEQYKRMQSQESSAKRSDEQRKMKEQQAAEELREKQAAEQERLKQLEKERLAAQEQKKQA
EEAAKQAELKQKQAEEAAAKAAADAKAKAEADAKAAEEAAKKAAADAKKKAEAEAAKAAA
EAQKKAEAAAAALKKKAEAAEAAAAEARKKAATEAAEKAKAEAEKKAAAEKAAADKKAAA
EKAAADKKAAEKAAAEKAAADKKAAAEKAAADKKAAAAKAAAEKAAAAKAAAEADDIFGE
LSSGKNAPKTGGGAKGNNASPAGSGNTKNNGASGADINNYAGQIKSAIESKFYDASSYAG
KTCTLRIKLAPDGMLLDIKPEGGDPALCQAALAAAKLAKIPKPPSQAVYEVFKNAPLDFK
P
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaaggcaaccgaacaaaacgacaagctcaagcgggcgataattatttcagcagtg
ctgcatgtcatcttatttgcggcgctgatctggagttcgttcgatgagaatatagaagct
tcagccggaggcggcggtggttcgtccatcgacgctgtcatggttgattcaggtgcggta
gttgagcagtacaaacgcatgcaaagccaggaatcaagcgcgaagcgttctgatgaacag
cgcaagatgaaggaacagcaggctgctgaagaactgcgtgagaaacaagcggctgaacag
gaacgcctgaagcaacttgagaaagagcggttagcggctcaggagcagaaaaagcaggct
gaagaagccgcaaaacaggccgagttaaagcagaagcaagctgaagaggcggcagcgaaa
gcggcggcagatgctaaagcgaaggccgaagcagatgctaaagctgcggaagaagcagcg
aagaaagcggctgcagacgcaaagaaaaaagcagaagcagaagccgccaaagccgcagcc
gaagcgcagaaaaaagccgaggcagccgctgcggcactgaagaagaaagcggaagcggca
gaagcagctgcagctgaagcaagaaagaaagcggcaactgaagctgctgaaaaagccaaa
gcagaagctgagaagaaagcggctgctgaaaaggctgcagctgataagaaagcggcagca
gagaaagctgcagccgacaaaaaagcagcagaaaaagcggctgctgaaaaggcagcagct
gataagaaagcagcggcagaaaaagccgccgcagacaaaaaagcggcagcggcaaaagct
gcagctgaaaaagccgctgcagcaaaagcggccgcagaggcagatgatattttcggtgag
ctaagctctggtaagaatgcaccgaaaacggggggaggggcgaaagggaacaatgcttcg
cctgccgggagtggtaatactaaaaacaatggcgcatcaggggccgatatcaataactat
gccgggcagattaaatctgctatcgaaagtaagttctatgacgcatcgtcctatgcaggc
aaaacctgtacgctgcgcataaaactggcacccgatggtatgttactggatatcaaacct
gaaggtggcgatcccgcactttgtcaggctgcgttggcagcagctaaacttgcgaagatc
ccgaaaccaccaagccaggcagtatatgaagtgttcaaaaacgcgccattggacttcaaa
ccgtaa

DBGET integrated database retrieval system