KEGG   Escherichia coli K-12 MG1655: b0740Help
Entry
b0740             CDS       T00007                                 

Gene name
tolB
Definition
(RefSeq) periplasmic protein
  KO
K03641  
TolB protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b0740 (tolB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
777740..779032
Genome map
AA seq 430 aa AA seqDB search
MKQALRVAFGFLILWASVLHAEVRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAA
DLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVD
TGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPY
ELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVA
SFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQ
NLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAK
QDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQ
VKFPAWSPYL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaggcattacgagtagcatttggttttctcatactgtgggcatcagttctgcat
gctgaagtccgcattgtgatcgacagcggtgtagattccggtcgtcctattggtgttgtt
cctttccagtgggcggggcctggtgcggcacctgaagatattggcggcatcgttgctgct
gacttgcgtaacagcggtaaatttaatccgttagatcgcgctcgtctgccacagcagccg
ggtagtgcgcaggaagtacaaccagctgcatggtccgcactgggcattgacgctgtagtt
gtcggtcaggtcactccgaatccggatggttcttacaatgttgcttatcaacttgttgac
actggcggcgcaccgggtactgtacttgctcagaactcgtacaaagtgaacaagcagtgg
ctgcgttatgctggtcataccgccagtgatgaagtgtttgaaaaactgaccggcattaaa
ggtgcgttccgtactcgtattgcctacgttgttcagaccaacggcggtcagttcccgtat
gaactgcgcgtatctgactatgacggttacaaccagtttgtcgttcaccgttcaccgcag
ccgctgatgtctccggcgtggtcaccagacggttctaaactggcttatgtgaccttcgaa
agcggtcgttccgcgctggttattcagacgctggcaaatggcgctgtacgtcaggtggct
tcattcccgcgtcacaacggtgcacctgcattctcgccagacggcagcaaactggcattc
gccttgtcgaaaaccggtagtctgaacctgtacgtaatggatttggcttctggtcagatc
cgccaggtgactgatggtcgcagtaacaataccgaaccgacctggttcccggatagccag
aacctggcatttacttctgaccaggccggtcgtccgcaggtttataaagtgaatatcaac
ggcggtgcgccacaacgtattacctgggaaggttcgcagaaccaggatgcggatgtcagc
agcgacggtaaatttatggtaatggtcagctccaatggtgggcagcagcacattgccaaa
caagatctggcaacgggaggcgtacaagttctgtcgtccacgttcctggatgaaacgcca
agtctggcacctaacggcactatggtaatctacagctcttctcaggggatgggatccgtg
ctgaatttggtttctacagatgggcgtttcaaagcgcgtcttccggcaactgatggacag
gtcaaattccctgcctggtcgccgtatctgtga

DBGET integrated database retrieval system