KEGG   Escherichia coli K-12 MG1655: b0752Help
Entry
b0752             CDS       T00007                                 

Gene name
zitB
Definition
(RefSeq) zinc efflux system
  KO
K16264  cobalt-zinc-cadmium efflux system protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b0752 (zitB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cation_efflux ZT_dimer Vut_1 OPT
Motif
Other DBs
NCBI-GeneID: 945348
NCBI-ProteinID: NP_415273
Pasteur: ybgR
RegulonDB: ECK120002993
ECOCYC: G6393
ASAP: ABE-0002549
UniProt: P75757
Position
complement(783882..784823)
Genome map
AA seq 313 aa AA seqDB search
MAHSHSHTSSHLPEDNNARRLLYAFGVTAGFMLVEVVGGFLSGSLALLADAGHMLTDTAA
LLFALLAVQFSRRPPTIRHTFGWLRLTTLAAFVNAIALVVITILIVWEAIERFRTPRPVE
GGMMMAIAVAGLLANILSFWLLHHGSEEKNLNVRAAALHVLGDLLGSVGAIIAALIIIWT
GWTPADPILSILVSLLVLRSAWRLLKDSVNELLEGAPVSLDIAELKRRMCREIPEVRNVH
HVHVWMVGEKPVMTLHVQVIPPHDHDALLDQIQHYLMDHYQIEHATIQMEYQPCHGPDCH
LNEGVSGHSHHHH
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactcacactcacacacgtcctcacacctgccagaagataataatgctcgtcgc
ttgttgtatgctttcggcgtgactgccgggtttatgctggtagaagtcgttggtggtttt
ctttctggttctctggcattgctggccgatgcgggtcatatgttgaccgatactgccgcc
ctgcttttcgccctactcgccgtgcaattttcacgtcgtcctcccaccattcgccacact
ttcggttggctaagactgaccacgctcgcggcgtttgtgaatgccatagccctcgtggta
attaccattttgattgtctgggaggcgatagaacgcttccgcacgccgcgtccggtcgag
ggcggcatgatgatggcaattgccgtggctgggttgctggcaaatatactttctttctgg
ttacttcatcacggcagcgaagagaaaaacctcaacgtacgagcagcggcactgcatgtg
ctcggggacctgctgggttcggttggggctattattgccgcgttgattattatctggact
ggctggacacctgctgaccccattctctcgatactggtgtcgcttctggttctgcgtagc
gcgtggcgactgttgaaagatagcgtgaatgaattacttgaaggtgcaccggtatcgctg
gatatcgctgaactgaagcgtcgtatgtgccgggaaatcccggaagtccgcaatgtgcac
catgtacatgtatggatggtaggcgagaagccggtgatgacgttgcatgtgcaggtgatc
ccgccacacgatcacgatgccttgttggatcagatccaacactacctgatggatcactat
cagattgagcacgccaccattcagatggaatatcaaccttgtcatgggccagactgccac
ctgaatgaaggggtgtctggccattcacatcatcaccattaa

DBGET integrated database retrieval system