KEGG   Escherichia coli K-12 MG1655: b0752Help
Entry
b0752             CDS       T00007                                 

Gene name
zitB
Definition
(RefSeq) zinc efflux system
  KO
K16264  
cobalt-zinc-cadmium efflux system protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b0752 (zitB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(783882..784823)
Genome map
AA seq 313 aa AA seqDB search
MAHSHSHTSSHLPEDNNARRLLYAFGVTAGFMLVEVVGGFLSGSLALLADAGHMLTDTAA
LLFALLAVQFSRRPPTIRHTFGWLRLTTLAAFVNAIALVVITILIVWEAIERFRTPRPVE
GGMMMAIAVAGLLANILSFWLLHHGSEEKNLNVRAAALHVLGDLLGSVGAIIAALIIIWT
GWTPADPILSILVSLLVLRSAWRLLKDSVNELLEGAPVSLDIAELKRRMCREIPEVRNVH
HVHVWMVGEKPVMTLHVQVIPPHDHDALLDQIQHYLMDHYQIEHATIQMEYQPCHGPDCH
LNEGVSGHSHHHH
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactcacactcacacacgtcctcacacctgccagaagataataatgctcgtcgc
ttgttgtatgctttcggcgtgactgccgggtttatgctggtagaagtcgttggtggtttt
ctttctggttctctggcattgctggccgatgcgggtcatatgttgaccgatactgccgcc
ctgcttttcgccctactcgccgtgcaattttcacgtcgtcctcccaccattcgccacact
ttcggttggctaagactgaccacgctcgcggcgtttgtgaatgccatagccctcgtggta
attaccattttgattgtctgggaggcgatagaacgcttccgcacgccgcgtccggtcgag
ggcggcatgatgatggcaattgccgtggctgggttgctggcaaatatactttctttctgg
ttacttcatcacggcagcgaagagaaaaacctcaacgtacgagcagcggcactgcatgtg
ctcggggacctgctgggttcggttggggctattattgccgcgttgattattatctggact
ggctggacacctgctgaccccattctctcgatactggtgtcgcttctggttctgcgtagc
gcgtggcgactgttgaaagatagcgtgaatgaattacttgaaggtgcaccggtatcgctg
gatatcgctgaactgaagcgtcgtatgtgccgggaaatcccggaagtccgcaatgtgcac
catgtacatgtatggatggtaggcgagaagccggtgatgacgttgcatgtgcaggtgatc
ccgccacacgatcacgatgccttgttggatcagatccaacactacctgatggatcactat
cagattgagcacgccaccattcagatggaatatcaaccttgtcatgggccagactgccac
ctgaatgaaggggtgtctggccattcacatcatcaccattaa

DBGET integrated database retrieval system