KEGG   Escherichia coli K-12 MG1655: b0764Help
Entry
b0764             CDS       T00007                                 

Gene name
modB
Definition
(RefSeq) molybdate transporter subunit
  KO
K02018  
molybdate transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Molybdate transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0764 (modB)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Molybdate transporter [MD:M00189] [OT]
    b0764 (modB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
795862..796551
Genome map
AA seq 229 aa AA seqDB search
MILTDPEWQAVLLSLKVSSLAVLFSLPFGIFFAWLLVRCTFPGKALLDSVLHLPLVLPPV
VVGYLLLVSMGRRGFIGERLYDWFGITFAFSWRGAVLAAAVMSFPLMVRAIRLALEGVDV
KLEQAARTLGAGRWRVFFTITLPLTLPGIIVGTVLAFARSLGEFGATITFVSNIPGETRT
IPSAMYTLIQTPGGESGAARLCIISIALAMISLLISEWLARISRERAGR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgatactgaccgatccagaatggcaggcagttttattaagcctgaaagtttcttccctg
gctgtgctgtttagcctgccgtttgggatcttttttgcctggttactggtgcgttgcacg
tttccgggcaaagctctgctcgacagcgtactgcatctaccgctggtgttaccgcccgtg
gtcgtcggttacttattattagtttcgatgggacggcgcggatttatcggtgaacgtctg
tatgactggtttggtattaccttcgcctttagctggcgcggcgcggttctcgctgccgcc
gtcatgtcgtttccgctgatggtgcgggcaattcgtctggcgctggaaggggttgatgtc
aaactggaacaggccgcaagaacactgggggccgggcgctggcgcgttttctttactatc
acgttaccgctgaccttaccgggaattattgttggtacggtactggcttttgctcgttct
ctcggtgagtttggtgcaaccatcacctttgtgtcgaacattcctggtgaaacgcgaacc
attccttctgccatgtataccctgatccagacccccggcggggaaagtggagcggcgaga
ctgtgcattatttctattgcgctggcgatgatctccctgttgatttcagaatggctggcc
agaatcagccgtgaacgggcggggcgctaa

DBGET integrated database retrieval system