KEGG   Escherichia coli K-12 MG1655: b0786Help
Entry
b0786             CDS       T00007                                 

Gene name
ybhL
Definition
(RefSeq) UPF0005 family inner membrane protein
  KO
K06890  
uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
819884..820588
Genome map
AA seq 234 aa AA seqDB search
MDRFPRSDSIVQPRAGLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMELLFTNRVFLI
GLIIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFVVTA
GMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIVFVG
LTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggacagattcccacgttctgattcaatcgtacaaccccgggctggcttgcaaacttat
atggctcaagtctatggctggatgaccgttggcttgttgctgaccgcatttgttgcctgg
tatgcggctaattccgcggccgtgatggagctgttgttcactaaccgtgtctttttaatc
ggtctgatcatcgcgcaattagcattggttattgtgttatcagcgatgattcaaaagctg
agcgcaggtgtaacgacgatgctctttatgctttattcggcgctgacgggtcttacgctt
tccagtatattcattgtctataccgctgcttctatcgccagtactttcgtcgttactgcc
gggatgttcggcgcaatgagcctgtacggttacaccacgaagcgcgatttaagtggcttt
ggcaatatgctgtttatggcgttaatcggcattgtgctggcatcgctggtcaacttctgg
ttgaaaagcgaagcattgatgtgggcagttacctacatcggcgtgattgtctttgtcgga
ttgacggcgtatgacacgcagaaactgaaaaatatgggtgagcagattgatacccgcgac
acgtcgaacctgcgcaaatattccattcttggcgcgttaaccttgtatctggacttcatc
aacctgttcctgatgttgttgcggatcttcggcaaccgccgttaa

DBGET integrated database retrieval system