KEGG   Escherichia coli K-12 MG1655: b0789Help
Entry
b0789             CDS       T00007                                 

Gene name
clsB
Definition
(RefSeq) cardiolipin synthase 2 (EC:2.7.8.-)
  KO
K06131  
cardiolipin synthase A/B [EC:2.7.8.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    b0789 (clsB)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     b0789 (clsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(822498..823739)
Genome map
AA seq 413 aa AA seqDB search
MKCSWREGNKIQLLENGEQYYPAVFKAIGEAQERIILETFIWFEDDVGKQLHAALLAAAQ
RGVKAEVLLDGYGSPDLSDEFVNELTAAGVVFRYYDPRPRLFGMRTNVFRRMHRKIVVID
ARIAFIGGLNYSAEHMSSYGPEAKQDYAVRLEGPIVEDILQFELENLPGQSAARRWWRRH
HKAEENRQPGEAQVLLVWRDNEEHRDDIERHYLKMLTQARREVIIANAYFFPGYRFLHAL
RKAARRGVRIKLIIQGEPDMPIVRVGARLLYNYLVKGGVQVFEYRRRPLHGKVALMDDHW
ATVGSSNLDPLSLSLNLEANVIIHDRHFNQTLRDNLNGIIAADCQQVDETMLPKRTWWNL
TKSVLAFHFLRHFPALVGWLPAHTPRLAQVDPPAQPTMETQDRVETENTGVKP
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtagctggcgcgaaggcaataagatccagttgctggaaaacggcgagcaatat
tatcccgcggtgtttaaggcgattggcgaggcacaagaacgcatcattcttgaaacgttt
atctggtttgaggatgacgtcggcaaacaactgcatgcggcactactggcagcagcgcaa
cgcggggttaaagcggaagtcttgctggatggctacggttcgccggatctcagcgatgag
tttgtcaatgaactgacggcagctggcgtagtgttccgctactacgatccccgccctcgc
ctttttggtatgcgcaccaatgtgtttcgccggatgcatcgcaaaattgtggtgatcgac
gcgcgtatagcctttattggcgggctgaattactccgccgagcatatgtccagctacggt
ccagaggctaaacaggattacgcggtacgccttgaagggccgattgtcgaagatattctc
cagtttgagctggaaaacctgcctggacagagcgcggcacgacgctggtggcgacgtcat
cacaaagcggaagagaaccgccagccgggagaagcgcaggtattgctggtctggcgcgat
aacgaagaacatcgcgatgatattgaacgccattatttgaaaatgctcactcaggcgcgg
cgggaagtgattatcgccaacgcctacttcttccccggctatcgatttttacacgccttg
cgtaaagcggcacggcgcggggtgcggatcaaactgatcattcagggcgaaccggatatg
ccgattgtcagagtcggtgcgcgcttgctgtataactatctggttaaaggcggcgttcag
gtttttgagtaccgccgccgcccgctccacggcaaagtggcattgatggacgatcactgg
gcgacagtagggtccagtaatctcgatccgctcagtttgtcactgaatctcgaagcaaat
gtcatcatccacgatcgtcattttaaccagacgctgcgcgataatctgaacggcattatt
gccgcagattgtcagcaggtggatgaaaccatgctgcccaaacgcacctggtggaacctg
accaaaagcgtgctggcgttccactttttacgccacttcccggcgctggttggctggctt
ccggcacacacgccacgtctggcgcaggttgatccgcccgcacaaccgacaatggaaacg
caggatcgggtagaaactgaaaacacgggggtaaaaccctga

DBGET integrated database retrieval system