KEGG   Escherichia coli K-12 MG1655: b0797Help
Entry
b0797             CDS       T00007                                 

Gene name
rhlE
Definition
(RefSeq) ATP-dependent RNA helicase
  KO
K11927  
ATP-dependent RNA helicase RhlE [EC:3.6.4.13]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    b0797 (rhlE)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     b0797 (rhlE)
Messenger RNA biogenesis [BR:eco03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     b0797 (rhlE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
830872..832236
Genome map
AA seq 454 aa AA seqDB search
MSFDSLGLSPDILRAVAEQGYREPTPIQQQAIPAVLEGRDLMASAQTGTGKTAGFTLPLL
QHLITRQPHAKGRRPVRALILTPTRELAAQIGENVRDYSKYLNIRSLVVFGGVSINPQMM
KLRGGVDVLVATPGRLLDLEHQNAVKLDQVEILVLDEADRMLDMGFIHDIRRVLTKLPAK
RQNLLFSATFSDDIKALAEKLLHNPLEIEVARRNTASDQVTQHVHFVDKKRKRELLSHMI
GKGNWQQVLVFTRTKHGANHLAEQLNKDGIRSAAIHGNKSQGARTRALADFKSGDIRVLV
ATDIAARGLDIEELPHVVNYELPNVPEDYVHRIGRTGRAAATGEALSLVCVDEHKLLRDI
EKLLKKEIPRIAIPGYEPDPSIKAEPIQNGRQQRGGGGRGQGGGRGQQQPRRGEGGAKSA
SAKPAEKPSRRLGDAKPAGEQQRRRRPRKPAAAQ
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcgattctttgggtttaagccctgatatcctgcgcgccgttgccgagcagggt
taccgtgaacccacccctattcagcagcaggcgatccctgcggtgctggaaggccgcgac
ctgatggctagcgcccagaccggcaccggcaaaacagcgggctttacgctgccgctgttg
caacacctgatcactcgccagccgcacgccaaagggcgtcgtccggtacgtgcgctcatt
cttaccccgacccgtgaactggcggcgcagattggcgaaaacgtccgtgattacagcaaa
tacctgaacattcgttcgctggtggtgtttggtggtgtgagtattaacccgcagatgatg
aaactgcgtggcggcgttgatgtgctggtggcaaccccgggacgtttgctggacctggaa
catcagaatgcagtgaagctggatcaggttgaaatcctcgtcctcgatgaagctgaccgc
atgctcgacatgggctttatccacgatatccgtcgcgtgttaacaaaactacctgcgaag
cgccagaacctgttattctccgcgaccttctctgacgatattaaagccctggcggaaaaa
ctgttgcacaacccgctggaaatcgaagtggcacgccgcaataccgcgtctgatcaggtg
acccagcacgttcactttgtcgataagaaacgcaaacgcgaattgctgtcgcacatgatt
gggaaagggaactggcagcaggtgctggtgtttacccgtaccaaacacggcgctaaccat
ctggctgaacagctcaataaagatggcatccgtagtgcggcgatccacggcaataaatcg
caaggtgcgcgtactcgtgcgctggctgattttaaatcgggcgatattcgtgtactggtg
gcaactgacatcgctgcgcgcggcctggatattgaagagctgccgcacgtcgtcaactat
gaactgccaaacgtacctgaagattatgtccaccgtatcgggcgtaccggtcgtgcggct
gctaccggtgaagcgttgtcgctggtgtgtgttgatgaacacaaactgctgcgtgatatc
gaaaaactgctgaaaaaagagatcccgcgcattgcgattccgggctatgagccggacccg
tcaatcaaagccgaaccgatccagaacggtcgccagcaacgtggcggcggcggtcgtggg
caaggtggtggtcgcggtcaacagcaaccacgccgtggggaaggtggcgcaaaatctgca
agcgcgaaacctgcagaaaaaccgtctcgccgcctcggcgatgccaaaccggcaggcgaa
caacaacgtcgccgccgtccgcgtaaacctgccgctgcgcagtaa

DBGET integrated database retrieval system