KEGG   Escherichia coli K-12 MG1655: b0832Help
Entry
b0832             CDS       T00007                                 

Gene name
gsiD
Definition
(RefSeq) glutathione transporter, permease component, ABC superfamily
  KO
K13891  
glutathione transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Glutathione transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0832 (gsiD)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Glutathione transporter [MD:M00348] [OT]
    b0832 (gsiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
871890..872801
Genome map
AA seq 303 aa AA seqDB search
MRLFNWRRQAVLNAMPLVKPDQVRTPWHEFWRRFRRQHMAMTAALFVILLIVVAIFARWI
APYDAENYFDYDNLNNGPSLQHWFGVDSLGRDIFSRVLVGAQISLAAGVFAVFIGAAIGT
LLGLLAGYYEGWWDRLIMRICDVLFAFPGILLAIAVVAVLGSGIANVIIAVAIFSIPAFA
RLVRGNTLVLKQQTFIESARSIGASDMTVLLRHILPGTVSSIVVFFTMRIGTSIISAASL
SFLGLGAQPPTPEWGAMLNEARADMVIAPHVAVFPALAIFLTVLAFNLLGDGLRDALDPK
IKG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcgactatttaactggcgacgtcaggcggtgttaaacgccatgccactggtcaaacct
gaccaggtacgtacaccgtggcatgaattctggcgacgatttcgccgtcagcatatggcg
atgaccgccgcattattcgttattttattgattgtggtggccatttttgcacgctggatc
gctccctatgacgccgaaaattattttgattatgacaatctgaataacggaccttctttg
cagcactggtttggcgtcgattcactggggcgtgacattttcagccgtgtcctggttggt
gcgcaaatctcgctggcggcgggcgtgtttgccgtgtttatcggtgcggcgatcgggacg
ttgctgggcttgctcgctggatattatgaaggctggtgggatcggctgatcatgcgcatt
tgcgatgtgctgtttgccttcccgggtattttactggcgatcgctgttgttgcggtgttg
ggaagcggcattgctaacgtgattattgcagtcgccattttttccatccccgcgtttgcc
cgcctggtgcgcggcaacacgctggtgttgaaacagcaaacctttattgagtcagcacgc
agtattggtgccagcgatatgaccgttttgttgcgtcatatcctgcctgggaccgtctct
tctatcgtggtgtttttcaccatgcgcattggtacctcgattatctctgccgccagcctc
tcatttctcggcctcggtgcgcagccgccgacaccagagtggggagcaatgctcaatgag
gctcgagcggatatggttatcgcgccgcatgtcgctgtttttccggccctggctattttt
ctgaccgtactggcgttcaatttgttgggcgatggtttacgcgatgcgctggatccgaaa
attaaaggatag

DBGET integrated database retrieval system