KEGG   Escherichia coli K-12 MG1655: b0842Help
Entry
b0842             CDS       T00007                                 

Gene name
mdfA
Definition
(RefSeq) multidrug efflux system protein
  KO
K08160  
MFS transporter, DHA1 family, multidrug/chloramphenicol efflux transport protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    b0842 (mdfA)
Antimicrobial resistance genes [BR:eco01504]
 Gene variants
  Macrolide resistance genes
   Transporters
    b0842 (mdfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
883673..884905
Genome map
AA seq 410 aa AA seqDB search
MQNKLASGARLGRQALLFPLCLVLYEFSTYIGNDMIQPGMLAVVEQYQAGIDWVPTSMTA
YLAGGMFLQWLLGPLSDRIGRRPVMLAGVVWFIVTCLAILLAQNIEQFTLLRFLQGISLC
FIGAVGYAAIQESFEEAVCIKITALMANVALIAPLLGPLVGAAWIHVLPWEGMFVLFAAL
AAISFFGLQRAMPETATRIGEKLSLKELGRDYKLVLKNGRFVAGALALGFVSLPLLAWIA
QSPIIIITGEQLSSYEYGLLQVPIFGALIAGNLLLARLTSRRTVRSLIIMGGWPIMIGLL
VAAAATVISSHAYLWMTAGLSIYAFGIGLANAGLVRLTLFASDMSKGTVSAAMGMLQMLI
FTVGIEISKHAWLNGGNGLFNLFNLVNGILWLSLMVIFLKDKQMGNSHEG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataaattagcttccggtgccaggcttggacgtcaggcgttacttttccctctc
tgtctggtgctttacgaattttcaacctatatcggcaacgatatgattcaacccggtatg
ttggccgtggtggaacaatatcaggcgggcattgattgggttcctacttcgatgaccgcg
tatctggcgggcgggatgtttttacaatggctgctggggccgctgtcggatcgtattggt
cgccgtccggtgatgctggcgggagtggtgtggtttatcgtcacctgtctggcaatattg
ctggcgcaaaacattgaacaattcaccctgttgcgcttcttgcagggcataagcctctgt
ttcattggcgctgtgggatacgccgcaattcaggaatccttcgaagaggcggtttgtatc
aagatcaccgcgctgatggcgaacgtggcgctgattgctccgctacttggtccgctggtg
ggcgcggcgtggatccatgtgctgccctgggaggggatgtttgttttgtttgccgcattg
gcagcgatctcctttttcggtctgcaacgagccatgcctgaaaccgccacgcgtataggc
gagaaactgtcactgaaagaactcggtcgtgactataagctggtgctgaagaacggccgc
tttgtggcgggggcgctggcgctgggattcgttagtctgccgttgctggcgtggatcgcc
cagtcgccgattatcatcattaccggcgagcagttgagcagctatgaatatggcttgctg
caagtgcctattttcggggcgttaattgcgggtaacttgctgttagcgcgtctgacctcg
cgccgcaccgtacgttcgctgattattatgggcggctggccgattatgattggtctattg
gtcgctgctgcggcaacggttatctcatcgcacgcgtatttatggatgactgccgggtta
agtatttatgctttcggtattggtctggcgaatgcgggactggtgcgattaaccctgttt
gccagcgatatgagtaaaggtacggtttctgccgcgatgggaatgctgcaaatgctgatc
tttaccgttggtattgaaatcagcaaacatgcctggctgaacgggggcaacggactgttt
aatctcttcaaccttgtcaacggaattttgtggctgtcgctgatggttatctttttaaaa
gataaacagatgggaaattctcacgaagggtaa

DBGET integrated database retrieval system