KEGG   Escherichia coli K-12 MG1655: b0844Help
Entry
b0844             CDS       T00007                                 

Gene name
ybjI
Definition
(RefSeq) 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase; pyrimidine phosphatase; riboflavin synthesis
  KO
K20861  
FMN hydrolase / 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase [EC:3.1.3.102 3.1.3.104]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    b0844 (ybjI)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.102  FMN hydrolase
     b0844 (ybjI)
    3.1.3.104  5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase
     b0844 (ybjI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(885316..886131)
Genome map
AA seq 271 aa AA seqDB search
MSIKLIAVDMDGTFLSDQKTYNRERFMAQYQQMKAQGIRFVVASGNQYYQLISFFPEIAN
EIAFVAENGGWVVSEGKDVFNGELSKDAFATVVEHLLTRPEVEIIACGKNSAYTLKKYDD
AMKTVAEMYYHRLEYVDNFDNLEDIFFKFGLNLSDELIPQVQKALHEAIGDIMVSVHTGN
GSIDLIIPGVHKANGLRQLQKLWGIDDSEVVVFGDGGNDIEMLRQAGFSFAMENAGSAVV
AAAKYRAGSNNREGVLDVIDKVLKHEAPFDQ
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagcattaaattaattgcggtagacatggatggtactttcttaagcgatcaaaaaacc
tataaccgtgagcggtttatggctcagtatcagcaaatgaaagcacaaggaattcgcttt
gtagtcgccagcgggaatcaatattatcagttgatctctttcttccctgaaattgctaat
gaaattgcctttgtggctgaaaacggcggctgggtagtgagcgaaggcaaagatgttttt
aatggcgagctatcgaaggatgcgtttgctactgtcgtggaacatttgctgacgcgcccg
gaagtggaaattattgcctgcggaaaaaatagtgcctatacactcaaaaaatatgacgat
gccatgaaaacggtggcggaaatgtattatcaccgtctggaatacgtcgataactttgac
aacttagaggatatcttctttaagtttggcctgaatctttccgatgaactgattccacaa
gtacaaaaagcattacatgaggccatcggcgatattatggtgtcggtccacaccggcaac
ggcagcatcgatctgattatccccggcgtacataaagccaatggccttcgccaactgcag
aaattatggggaatagacgacagcgaagtggtggtctttggcgatggcggtaacgatatt
gagatgctgcgtcaggcaggctttagttttgcaatggaaaatgccggtagcgcggtcgtc
gcagcggcaaaataccgcgcaggctccaataaccgtgaaggcgtactggatgtgatcgat
aaagttcttaaacacgaagcgccatttgaccaataa

DBGET integrated database retrieval system