KEGG   Escherichia coli K-12 MG1655: b0845Help
Entry
b0845             CDS       T00007                                 

Gene name
ybjJ
Definition
(RefSeq) putative transporter
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(886131..887339)
Genome map
AA seq 402 aa AA seqDB search
MTVNSSRNALKRRTWALFMFFFLPGLLMASWATRTPAIRDILSVSIAEMGGVLFGLSIGS
MSGILCSAWLVKRFGTRNVILVTMSCALIGMMILSLALWLTSPLLFAVGLGVFGASFGSA
EVAINVEGAAVEREMNKTVLPMMHGFYSLGTLAGAGVGMALTAFGVPATVHILLAALVGI
APIYIAIQAIPDGTGKNAADGTQHGEKGVPFYRDIQLLLIGVVVLAMAFAEGSANDWLPL
LMVDGHGFSPTSGSLIYAGFTLGMTVGRFTGGWFIDRYSRVAVVRASALMGALGIGLIIF
VDSAWVAGVSVVLWGLGASLGFPLTISAASDTGPDAPTRVSVVATTGYLAFLVGPPLLGY
LGEHYGLRSAMLVVLALVILAAIVAKAVAKPDTKTQTAMENS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtaaattcttcacgtaatgcattgaaacgccgaacctgggcgctgtttatgttc
ttctttttgccaggcctgttaatggcgtcctgggcaacccgtacgcctgctatccgcgat
attctctctgtctcgatcgctgaaatgggcggtgttctctttggtctgtcgatcggttcg
atgagcggtattctctgctcggcgtggttagtgaaacgctttgggacacgtaatgtcatc
ctggtcacgatgtcctgcgcattgatcgggatgatgatattaagtctggcactctggctg
acatcgcccctgctctttgccgttggtctcggcgtctttggggcaagttttggttctgcg
gaagtggcgataaacgttgaaggtgctgccgttgagcgagaaatgaataagacggttttg
ccgatgatgcacggtttttatagcctgggcacgctggcaggcgcaggtgtcgggatggca
ctgacggcctttggcgttccggcaacggtgcacattttattggcggcgctggtaggtatc
gcacctatttatatcgccattcaggcaatccctgacggtacgggcaaaaatgctgccgat
ggcacccagcatggcgaaaaaggcgtacctttttatcgcgatatccagttgctgctgata
ggtgttgtggtgctggcgatggcctttgccgaaggttctgccaacgactggttaccctta
ttaatggttgacggtcacggttttagccctacttccggctcgctgatttatgccggtttt
accctggggatgaccgttggacgcttcaccggcggttggttcatcgaccgttacagtcgc
gttgccgtggttcgggccagtgcactaatgggggcgttgggtattgggctgattattttt
gtcgatagcgcctgggtcgctggggtgtctgttgtactctggggactgggtgcctcgctg
ggcttcccgctgaccatttctgccgccagcgataccggccccgatgcaccaacccgcgtc
agtgtggtagcaacgaccggttatctggctttcctcgtcgggccgccgctgctgggctat
ctcggcgaacattatggattacgtagtgcaatgctggttgtactggcgctggttattctc
gcggctattgtcgcgaaagccgtcgccaaacccgataccaaaacgcagacggcgatggag
aatagttga

DBGET integrated database retrieval system