KEGG   Escherichia coli K-12 MG1655: b0854Help
Entry
b0854             CDS       T00007                                 

Gene name
potF
Definition
(RefSeq) putrescine ABC transporter periplasmic binding protein
  KO
K11073  putrescine transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Module
eco_M00300  Putrescine transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0854 (potF)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putrescine transporter [MD:M00300] [OT]
    b0854 (potF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_6 SBP_bac_1 SBP_bac_11 Lipoprotein_8 P21-Arc
Motif
Other DBs
NCBI-GeneID: 945480
NCBI-ProteinID: NP_415375
Pasteur: potF
RegulonDB: ECK120001577
ECOCYC: EG11629
ASAP: ABE-0002913
UniProt: P31133
Structure
PDB: 

Jmol
Position
893784..894896
Genome map
AA seq 370 aa AA seqDB search
MTALNKKWLSGLVAGALMAVSVGTLAAEQKTLHIYNWSDYIAPDTVANFEKETGIKVVYD
VFDSNEVLEGKLMAGSTGFDLVVPSASFLERQLTAGVFQPLDKSKLPEWKNLDPELLKLV
AKHDPDNKFAMPYMWATTGIGYNVDKVKAVLGENAPVDSWDLILKPENLEKLKSCGVSFL
DAPEEVFATVLNYLGKDPNSTKADDYTGPATDLLLKLRPNIRYFHSSQYINDLANGDICV
AIGWAGDVWQASNRAKEAKNGVNVSFSIPKEGAMAFFDVFAMPADAKNKDEAYQFLNYLL
RPDVVAHISDHVFYANANKAATPLVSAEVRENPGIYPPADVRAKLFTLKVQDPKIDRVRT
RAWTKVKSGK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccttaaataaaaaatggctatcgggtctggttgcgggtgctctgatggccgtc
tctgtcggcacgctcgcggctgaacaaaaaacactccacatttataactggtctgattat
atcgccccggacacggtggccaattttgaaaaagaaaccggtattaaagtcgtctacgat
gttttcgactctaacgaagtactggaaggcaaattaatggccgggagtaccggctttgat
ctggtggttccatctgccagctttctggagcgccagttgactgcgggagttttccagccg
ctggacaaaagcaaattgccggagtggaagaatctcgacccggaactgctgaagctggtc
gccaaacacgatcccgacaataaatttgctatgccctatatgtgggcgacgaccgggatt
ggctataacgttgataaagttaaagcggtgctgggcgaaaacgcgcccgtcgatagctgg
gacttgatcctcaaacctgaaaatctggaaaaactgaaaagctgcggtgtctctttcctg
gatgcgccagaagaagtttttgctaccgtgttgaattatctcggcaaagatcccaacagc
actaaagcggatgattacaccggaccggcaacagatctgctgttaaagctgcgcccgaac
attcgttatttccattcatctcaatacattaacgacctggcaaacggcgatatttgcgtc
gctatcggctgggcaggtgatgtctggcaggcgtcaaaccgcgcgaaggaagcgaagaat
ggcgtgaatgtctcgttctcgattccaaaagaaggggcgatggcgttctttgatgtattc
gccatgcctgcggatgccaaaaacaaagacgaagcctatcagttcctgaattacctgctg
cgcccggatgtagtagcgcatatttccgaccatgtgttctatgccaacgccaataaagca
gccacgccgctggtgagtgcggaagtccgtgagaacccaggtatttatccgcctgcggat
gttcgtgcgaagctgttcactctgaaagtgcaggatccgaaaatcgaccgtgtgcgcacc
cgcgcgtggaccaaagtgaagagcggaaaataa

DBGET integrated database retrieval system