KEGG   Escherichia coli K-12 MG1655: b0856Help
Entry
b0856             CDS       T00007                                 

Gene name
potH
Definition
(RefSeq) putrescine transporter subunit: membrane component of ABC superfamily
  KO
K11075  
putrescine transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Putrescine transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0856 (potH)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putrescine transporter [MD:M00300] [OT]
    b0856 (potH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
896134..897087
Genome map
AA seq 317 aa AA seqDB search
MSTLEPAAQSKPPGGFKLWLSQLQMKHGRKLVIALPYIWLILLFLLPFLIVFKISLAEMA
RAIPPYTELMEWADGQLSITLNLGNFLQLTDDPLYFDAYLQSLQVAAISTFCCLLIGYPL
AWAVAHSKPSTRNILLLLVILPSWTSFLIRVYAWMGILKNNGVLNNFLLWLGVIDQPLTI
LHTNLAVYIGIVYAYVPFMVLPIYTALIRIDYSLVEAALDLGARPLKTFFTVIVPLTKGG
IIAGSMLVFIPAVGEFVIPELLGGPDSIMIGRVLWQEFFNNRDWPVASAVAIIMLLLLIV
PIMWFHKHQQKSVGEHG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacttgaacctgctgcccagtcgaaaccgccgggcggatttaagctgtggttg
tcgcagctgcaaatgaagcatgggcgcaaactggtcattgcgttgccatatatctggttg
atcttgctgtttctgctgccatttctgattgtctttaaaataagcctggcggagatggcg
cgcgctattccaccttataccgaactgatggagtgggctgacgggcaactgtccatcact
cttaatctcggtaattttctgcaactgaccgacgatccgctctatttcgatgcttatctc
cagtcgctacaggtggctgcgatttcgacattttgctgtttactgatcggctatccgctg
gcgtgggcggtggcgcacagtaagccttcgacccgtaatattttattactactggtgatc
ctgccgtcgtggacctcgtttctgatccgcgtttatgcctggatgggaatattaaaaaac
aacggtgtgctgaataattttctgctgtggctgggggttatcgatcaaccgctgaccatt
ctgcataccaatctggccgtttatatcggcattgtttacgcttacgtgccgtttatggta
ctgccgatttataccgcgttgattcgtattgattattcgctggtggaagcagcgctggat
ctcggtgcacgaccgctgaaaacgttctttactgtgatcgtgccgctgactaaaggtggg
attattgccggatcgatgctggtgtttatcccggctgtgggcgagtttgtgatcccggaa
ctgctcggtggcccggacagcatcatgatcgggcgcgtgctatggcaagagtttttcaat
aaccgcgactggccggtggcctcggcggtagcgatcatcatgttgctgctgctaattgtg
ccgataatgtggttccacaaacaccagcaaaaaagcgtgggagaacacggatga

DBGET integrated database retrieval system