KEGG   Escherichia coli K-12 MG1655: b0861Help
Entry
b0861             CDS       T00007                                 

Gene name
artM
Definition
(RefSeq) arginine transporter subunit
  KO
K09998  
arginine transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Arginine transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0861 (artM)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Arginine transporter [MD:M00229] [OT]
    b0861 (artM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(900866..901534)
Genome map
AA seq 222 aa AA seqDB search
MFEYLPELMKGLHTSLTLTVASLIVALILALIFTIILTLKTPVLVWLVRGYITLFTGTPL
LVQIFLIYYGPGQFPTLQEYPALWHLLSEPWLCALIALSLNSAAYTTQLFYGAIRAIPEG
QWQSCSALGMSKKDTLAILLPYAFKRSLSSYSNEVVLVFKSTSLAYTITLMEVMGYSQLL
YGRTYDVMVFGAAGIIYLVVNGLLTLMMRLIERKALAFERRN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagtatttacccgaactgatgaaagggctacacaccagcctgacgctaaccgtt
gcctcgctgattgtggcactgattctggcattgatttttaccatcatcctgacgctgaaa
acgccggtgctggtgtggctggtgcggggttatatcacgctgtttaccggtacgccgctg
ctggtgcagatcttcctgatttattacgggccgggccagtttccgactttgcaggagtat
ccggcactgtggcatttgttgtcagaaccgtggttatgtgcgctgattgcgttgtcgctg
aatagtgcggcgtataccacgcagctgttttacggtgcaattcgtgcgatcccggaaggt
cagtggcagtcctgtagcgccctgggaatgagcaaaaaagatacgctggcgatcctgctg
ccgtatgcctttaaacgctcgctctcttcttattccaacgaagtggtgctggtattcaaa
agtacctctctggcatacaccattacgctgatggaagtgatgggatacagccagttgttg
tacggacgcacctacgatgtaatggtgttcggtgcggcagggattatttacctggtcgtt
aacggcctgctgacgctgatgatgcgtctgatcgagcgcaaagcgctggcattcgaacgg
cgaaattaa

DBGET integrated database retrieval system