KEGG   Escherichia coli K-12 MG1655: b0861Help
Entry
b0861             CDS       T00007                                 

Gene name
artM
Definition
(RefSeq) arginine ABC transporter permease
  KO
K09998  arginine transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Module
eco_M00229  Arginine transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0861 (artM)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Arginine transporter [MD:M00229] [OT]
    b0861 (artM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 949066
NCBI-ProteinID: NP_415382
Pasteur: artM
RegulonDB: ECK120001575
ECOCYC: EG11627
ASAP: ABE-0002931
UniProt: P0AE30
Position
complement(900866..901534)
Genome map
AA seq 222 aa AA seqDB search
MFEYLPELMKGLHTSLTLTVASLIVALILALIFTIILTLKTPVLVWLVRGYITLFTGTPL
LVQIFLIYYGPGQFPTLQEYPALWHLLSEPWLCALIALSLNSAAYTTQLFYGAIRAIPEG
QWQSCSALGMSKKDTLAILLPYAFKRSLSSYSNEVVLVFKSTSLAYTITLMEVMGYSQLL
YGRTYDVMVFGAAGIIYLVVNGLLTLMMRLIERKALAFERRN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagtatttacccgaactgatgaaagggctacacaccagcctgacgctaaccgtt
gcctcgctgattgtggcactgattctggcattgatttttaccatcatcctgacgctgaaa
acgccggtgctggtgtggctggtgcggggttatatcacgctgtttaccggtacgccgctg
ctggtgcagatcttcctgatttattacgggccgggccagtttccgactttgcaggagtat
ccggcactgtggcatttgttgtcagaaccgtggttatgtgcgctgattgcgttgtcgctg
aatagtgcggcgtataccacgcagctgttttacggtgcaattcgtgcgatcccggaaggt
cagtggcagtcctgtagcgccctgggaatgagcaaaaaagatacgctggcgatcctgctg
ccgtatgcctttaaacgctcgctctcttcttattccaacgaagtggtgctggtattcaaa
agtacctctctggcatacaccattacgctgatggaagtgatgggatacagccagttgttg
tacggacgcacctacgatgtaatggtgttcggtgcggcagggattatttacctggtcgtt
aacggcctgctgacgctgatgatgcgtctgatcgagcgcaaagcgctggcattcgaacgg
cgaaattaa

DBGET integrated database retrieval system