KEGG   Escherichia coli K-12 MG1655: b0863Help
Entry
b0863             CDS       T00007                                 

Gene name
artI
Definition
(RefSeq) arginine transporter subunit
  KO
K09997  arginine transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Module
eco_M00229  Arginine transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0863 (artI)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Arginine transporter [MD:M00229] [OT]
    b0863 (artI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd
Motif
Other DBs
NCBI-GeneID: 948988
NCBI-ProteinID: NP_415384
Pasteur: artI
RegulonDB: ECK120001573
ECOCYC: EG11625
ASAP: ABE-0002937
UniProt: P30859
Position
complement(902257..902988)
Genome map
AA seq 243 aa AA seqDB search
MKKVLIAALIAGFSLSATAAETIRFATEASYPPFESIDANNQIVGFDVDLAQALCKEIDA
TCTFSNQAFDSLIPSLKFRRVEAVMAGMDITPEREKQVLFTTPYYDNSALFVGQQGKYTS
VDQLKGKKVGVQNGTTHQKFIMDKHPEITTVPYDSYQNAKLDLQNGRIDGVFGDTAVVTE
WLKDNPKLAAVGDKVTDKDYFGTGLGIAVRQGNTELQQKLNTALEKVKKDGTYETIYNKW
FQK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttctgattgccgcgttaattgcaggttttagtctttccgccacagctgcc
gaaaccattcgttttgctaccgaagcctcctatcctccgtttgaatcgattgatgcaaac
aaccagatcgttggttttgacgtcgacctggcacaagcgctgtgtaaagagattgatgca
acctgcactttctctaaccaggcgtttgacagcctgatcccaagcctgaaattccgtcgc
gtagaagccgtgatggcgggcatggatatcactccggagcgtgaaaagcaggtgctgttt
accaccccgtactatgacaactctgccctgtttgtgggtcagcaaggcaaatacaccagt
gttgatcagctgaaaggcaaaaaagtcggcgtacagaacgggacgacacaccagaaattc
attatggataagcacccggaaatcactaccgttccgtatgacagctaccagaacgcaaaa
ctggatctgcaaaacgggcgtatcgacggcgtcttcggtgacaccgcagtggtcactgag
tggctgaaagataacccgaaactggcggcggtgggcgacaaagtgaccgataaagattac
ttcggcactggcctcggcatcgcggtacgtcagggcaacactgagctgcagcagaaactc
aacactgcgctggaaaaagtgaagaaagatggcacttacgaaaccatctacaacaaatgg
ttccagaagtaa

DBGET integrated database retrieval system