KEGG   Escherichia coli K-12 MG1655: b0864Help
Entry
b0864             CDS       T00007                                 

Gene name
artP
Definition
(RefSeq) arginine transporter subunit
  KO
K10000  
arginine transport system ATP-binding protein [EC:3.6.3.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Arginine transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0864 (artP)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     b0864 (artP)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Arginine transporter [MD:M00229] [OT]
    b0864 (artP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(903006..903734)
Genome map
AA seq 242 aa AA seqDB search
MSIQLNGINCFYGAHQALFDITLDCPQGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLN
IAGNHFDFTKTPSDKAIRDLRRNVGMVFQQYNLWPHLTVQQNLIEAPCRVLGLSKDQALA
RAEKLLERLRLKPYSDRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQI
VSIIRELAETNITQVIVTHEVEVARKTASRVVYMENGHIVEQGDASCFTEPQTEAFKNYL
SH
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgagtattcaattaaacggcattaattgcttctacggcgcgcatcaggcgctgttcgat
atcacgctggattgcccacagggcgaaacgctggtgttacttggccccagcggcgcgggt
aaaagctcgctgctgcgtgtactcaatctgcttgagatgccgcgctccggtacgctcaac
attgcaggcaaccatttcgatttcaccaaaacaccctctgacaaagcgattcgcgatttg
cgtcgtaacgttggcatggtgtttcagcaatacaacctgtggccgcatctgaccgtgcag
caaaacctgattgaagcgccctgccgtgtactggggttgagtaaagatcaggcgctggcc
cgtgcagaaaaactgctggaacgtctgcgtctcaaaccttatagcgatcgttacccgctg
catctttctggtggtcagcagcagcgtgttgctattgcccgtgcgttgatgatggaaccg
caggtactgctgttcgatgaaccgaccgccgcactggacccggaaattacggcacaaatc
gtcagcatcattcgtgagctggcagaaacgaatattacccaggtgatcgtcacccacgaa
gttgaagtggcgcgtaaaaccgccagccgagtggtgtatatggaaaatggtcatatcgta
gaacaaggcgacgcgagctgctttaccgagccgcaaaccgaagcatttaaaaactatctc
tctcactaa

DBGET integrated database retrieval system