KEGG   Escherichia coli K-12 MG1655: b0875Help
Entry
b0875             CDS       T00007                                 

Gene name
aqpZ
Definition
(RefSeq) aquaporin Z
  KO
K06188  
aquaporin Z
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    b0875 (aqpZ)
Ion channels [BR:eco04040]
 Non-ion channels
  Aquaporins
   b0875 (aqpZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(915352..916047)
Genome map
AA seq 231 aa AA seqDB search
MFRKLAAECFGTFWLVFGGCGSAVLAAGFPELGIGFAGVALAFGLTVLTMAFAVGHISGG
HFNPAVTIGLWAGGRFPAKEVVGYVIAQVVGGIVAAALLYLIASGKTGFDAAASGFASNG
YGEHSPGGYSMLSALVVELVLSAGFLLVIHGATDKFAPAGFAPIAIGLALTLIHLISIPV
TNTSVNPARSTAVAIFQGGWALEQLWFFWVVPIVGGIIGGLIYRTLLEKRD
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgttcagaaaattagcagctgaatgttttggtactttctggcttgtttttggtggctgt
ggtagtgctgtactggccgcaggcttcccggaattaggcattggttttgccggcgtggcg
ttggcgttcggtctgaccgttctgacgatggcctttgctgttggtcatatttctggtggt
cattttaacccggcggtcactattggtttatgggctggcggacgttttccggcaaaagaa
gtcgttggctacgtaattgcccaggttgtcggcggtattgttgcagcggcgctgctgtat
ttaattgccagtggtaaaacgggttttgacgcggcagccagcggttttgcttctaacggt
tatggcgagcattcaccaggcggttattccatgctttccgcgctggtagttgaactggta
ttgagtgcaggtttcctgttggtgatccacggcgcaaccgacaaattcgcgccggcaggt
tttgcgccgatcgctattggtctggccttaaccctgattcacttaattagtattccggtg
actaacacttctgttaacccggcgcgcagcaccgcggttgctatcttccagggcggctgg
gcattagaacaactgtggttcttctgggtggtgccaattgtcggcggcattatcggtggt
ctgatttaccggaccctgctggaaaagcgtgattaa

DBGET integrated database retrieval system