KEGG   Escherichia coli K-12 MG1655: b0878Help
Entry
b0878             CDS       T00007                                 

Gene name
macA
Definition
(RefSeq) macrolide transporter subunit, membrane fusion protein (MFP) component
  KO
K13888  
membrane fusion protein, macrolide-specific efflux system
Organism
eco  Escherichia coli K-12 MG1655
Module
Macrolide resistance, MacAB-TolC transporter
Brite
Transporters [BR:eco02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   b0878 (macA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
919235..920350
Genome map
AA seq 371 aa AA seqDB search
MKKRKTVKKRYVIALVIVIAGLITLWRILNAPVPTYQTLIVRPGDLQQSVLATGKLDALR
KVDVGAQVSGQLKTLSVAIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQRQQAEA
ELKLARVTYSRQQRLAQTKAVSQQDLDTAATEMAVKQAQIGTIDAQIKRNQASLDTAKTN
LDYTRIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSAMLVKAQVSEADVIHLKPG
QKAWFTVLGDPLTRYEGQIKDVLPTPEKVNDAIFYYARFEVPNPNGLLRLDMTAQVHIQL
TDVKNVLTIPLSALGDPVGDNRYKVKLLRNGETREREVTIGARNDTDVEIVKGLEAGDEV
VIGEAKPGAAQ
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcggaaaaccgtgaagaagcgttacgttattgcgctggtgatagtcatcgcc
ggactgattacgttatggagaattcttaacgcacccgtgccgacttatcagacgctgatt
gtgcgccccggtgatttacagcaaagcgtgctggcgaccggaaagctggacgcgctgcgt
aaggttgatgtgggcgcgcaggtcagcggtcagttgaaaactctgtcggtggcgattggc
gataaagtaaaaaaagaccagcttttaggggttattgatcctgaacaggctgaaaaccag
attaaggaggtcgaagcaacgctgatggagctacgtgcgcagcggcagcaggcggaagcg
gagctgaaactggcgcgggtgacgtattcccgtcagcaacgtctggcacaaacgaaggct
gtttcacagcaggatctcgacaccgccgcgacggagatggctgtgaaacaggcgcaaatt
ggcaccattgacgcgcaaatcaagcgcaatcaggcttctctcgatacggctaaaaccaat
ctcgattacactcgcatcgttgccccgatggccggggaagtcacgcaaatcaccactctg
caaggccagacggtgattgccgcacaacaagcaccgaacattctgacgctggcagatatg
agcgccatgctggtaaaagcgcaggtttctgaagcggatgtaatccacctgaagccgggg
caaaaagcctggtttacggtgcttggcgatccactgacgcgctacgaggggcaaatcaag
gatgtactaccgacgccggaaaaggttaacgacgctattttctattacgcccgttttgaa
gtccccaaccccaatggtttgctgcggctggatatgactgcgcaagtgcatattcagctc
accgatgtgaaaaatgtgctgacgatccctctgtcggcgttaggcgatccggttggcgat
aatcgttataaagtcaaattgttgcgtaatggtgaaacacgcgagcgtgaagtgacgatt
ggcgcacgtaacgataccgatgttgagattgtcaaagggcttgaagcgggcgatgaagtg
gtgattggtgaggccaaaccaggagctgcacaatga

DBGET integrated database retrieval system