KEGG   Escherichia coli K-12 MG1655: b0879Help
Entry
b0879             CDS       T00007                                 

Gene name
macB
Definition
(RefSeq) macrolide ABC transporter peremase/ATPase
  KO
K05685  macrolide transport system ATP-binding/permease protein [EC:3.6.3.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Module
eco_M00709  Macrolide resistance, MacAB-TolC transporter
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0879 (macB)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     b0879 (macB)
Transporters [BR:eco02000]
 ABC Transporters, Eukaryotic Type
  Other subfamilies
   Macrolide exporter
    b0879 (macB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MacB_PCD ABC_tran FtsX SMC_N AAA_21 AAA_29 AAA_30 AAA_22 RsgA_GTPase AAA_16 AAA_33 ABC2_membrane_3 MMR_HSR1 DUF4396 AAA_28 Mlf1IP AAA_23 DUF87 Glyco_transf_4 DUF4064 AAA_24 AAA_18
Motif
Other DBs
NCBI-GeneID: 945164
NCBI-ProteinID: NP_415400
Pasteur: ybjZ
RegulonDB: ECK120003062
ECOCYC: G6462
ASAP: ABE-0002989
UniProt: P75831
Structure
PDB: 

Jmol
Position
920347..922293
Genome map
AA seq 648 aa AA seqDB search
MTPLLELKDIRRSYPAGDEQVEVLKGISLDIYAGEMVAIVGASGSGKSTLMNILGCLDKA
TSGTYRVAGQDVATLDADALAQLRREHFGFIFQRYHLLSHLTAEQNVEVPAVYAGLERKQ
RLLRAQELLQRLGLEDRTEYYPAQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG
EEVMAILHQLRDRGHTVIIVTHDPQVAAQAERVIEIRDGEIVRNPPAIEKVNVTGGTEPV
VNTVSGWRQFVSGFNEALTMAWRALAANKMRTLLTMLGIIIGIASVVSIVVVGDAAKQMV
LADIRSIGTNTIDVYPGKDFGDDDPQYQQALKYDDLIAIQKQPWVASATPAVSQNLRLRY
NNVDVAASANGVSGDYFNVYGMTFSEGNTFNQEQLNGRAQVVVLDSNTRRQLFPHKADVV
GEVILVGNMPARVIGVAEEKQSMFGSSKVLRVWLPYSTMSGRVMGQSWLNSITVRVKEGF
DSAEAEQQLTRLLSLRHGKKDFFTWNMDGVLKTVEKTTRTLQLFLTLVAVISLVVGGIGV
MNIMLVSVTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGITLSLLIAFTLQL
FLPGWEIGFSPLALLLAFLCSTVTGILFGWLPARNAARLDPVDALARE
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctttgctcgaattaaaggatattcgtcgcagctatcctgccggtgatgagcag
gttgaggtgctgaagggcatcagcctcgatatttatgcgggtgagatggtcgcgattgtt
ggcgcttcgggttccggtaaatcgaccctgatgaatattctcggctgtctggataaggcc
accagcggcacctatcgcgtcgccggtcaggatgttgccacgctggacgccgatgcgctg
gcgcaactgcgccgcgagcatttcggctttattttccagcgttaccatttgctttcgcat
ttaaccgccgagcagaacgttgaagtacccgccgtctatgctggtcttgagcggaaacag
cgactgcttcgtgcccaggagttgctgcaacggctggggctggaagaccgtacagagtat
tatccggcacagctttcgggtggtcagcaacagcgcgtcagcatcgcgcgggcattgatg
aacggtggtcaggtaattcttgccgatgaaccaaccggcgcactggacagccattctggc
gaagaggtgatggcgatcctgcatcagctgcgcgatcgtgggcatacggtgattatcgtc
acccacgatccgcaggtcgctgctcaggccgagcgggtgatcgaaattcgcgacggcgaa
attgtgcgcaatcctcccgccattgaaaaagtgaatgttactggcgggacggaacctgtt
gtcaacacggtgtctggctggcggcagtttgtcagcggttttaacgaggcgctgacgatg
gcatggcgggcgctggcagcgaataaaatgcgtactttactgaccatgctggggattatt
atcggtattgcgtcggtggtttccattgtcgtggtgggtgacgccgccaaacaaatggtg
ctggcggatattcgttctattggtacgaatactattgatgtctatcccgggaaagatttt
ggcgatgacgatccgcaatatcagcaggcgctgaagtacgacgacttaatcgccatccaa
aaacaaccgtgggtcgcctcagccacacctgccgtctcgcaaaacctgcgcctgcgttat
aacaatgttgatgttgctgccagtgccaatggcgtgagcggcgattattttaatgtctat
ggcatgaccttcagtgaaggaaacacctttaatcaggagcagctgaacggtcgtgcgcag
gtcgtggttctcgacagtaatactcgccgccagcttttcccccataaagcagatgtggtt
ggcgaggtgattctggtcggcaatatgcccgccagagtcattggtgtggcggaagaaaaa
cagtcgatgtttggtagcagtaaagtgctgcgtgtctggctaccttacagcacgatgtcc
gggcgagttatgggccagtcgtggcttaactccattactgtcagggtgaaagaaggattt
gacagcgccgaggcggaacagcaactcacgcgtttactttcactgcgccacggaaagaag
gatttctttacctggaacatggacggcgtcttgaaaactgttgaaaagaccacacgtact
ttacaactgtttctgacgctggtggcggtgatttcgctggtggtgggcggtattggtgta
atgaatattatgctggtgtcagtgaccgagcggacgcgggaaattggcattcgcatggct
gtaggtgcgcgagcaagcgatgttttgcaacagttcctgatcgaagccgtactggtttgc
ctggtcggtggcgcgttgggaataacactgtcactgttaattgctttcaccttgcagctt
ttcttacccggctgggagattggtttttcaccgttggcgctgctgctggcgtttctctgc
tcgacggtcaccgggattttatttggctggttacccgcacgaaatgcggcacgactggat
ccagtagatgctctggcacgagagtaa

DBGET integrated database retrieval system