KEGG   Escherichia coli K-12 MG1655: b0885Help
Entry
b0885             CDS       T00007                                 

Gene name
aat
Definition
(RefSeq) leucyl/phenylalanyl-tRNA-protein transferase (EC:2.3.2.6)
  KO
K00684  
leucyl/phenylalanyl-tRNA--protein transferase [EC:2.3.2.6]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.6  leucyltransferase
     b0885 (aat)
Transfer RNA biogenesis [BR:eco03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    b0885 (aat)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(926728..927432)
Genome map
AA seq 234 aa AA seqDB search
MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWS
PDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAY
HRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGH
GGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctggttcagctttctcgccattcaatagccttcccttccccggaaggcgcatta
cgtgagcctaacggcctgctggcacttgggggcgatcttagccctgcgcgcctgttaatg
gcttaccagcgtggtatttttccgtggttttctccaggcgaccccatcctctggtggtcg
cccgatccccgcgcggtgctatggccagaatcactgcatatcagccgtagtatgaagcga
tttcataaacgctcgccctatcgtgtcacgatgaattacgcttttggtcaggtcattgaa
ggctgtgccagcgatcgcgaagaaggaacctggatcacgcgtggcgtggtcgaagcctac
catcgccttcacgaactcggccatgcccactccattgaagtctggcgtgaagatgagctt
gtcggcggtatgtacggcgtggcccagggaacgctattttgtggcgagtccatgttcagc
cggatggaaaatgcgtctaaaacggcgcttctggtattctgtgaggaatttatcggtcat
ggcggtaagcttatcgactgccaggtccttaacgatcacacagcatcgcttggtgcctgc
gaaattccccgccgggattaccttaattatctcaatcaaatgcgcctcggacgattgccg
aataatttctgggtaccacgatgcttgttttcaccacaagaatga

DBGET integrated database retrieval system