KEGG   Escherichia coli K-12 MG1655: b0904Help
Entry
b0904             CDS       T00007                                 

Gene name
focA
Definition
(RefSeq) formate channel
  KO
K06212  
formate transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b0904 (focA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(953609..954466)
Genome map
AA seq 285 aa AA seqDB search
MKADNPFDLLLPAAMAKVAEEAGVYKATKHPLKTFYLAITAGVFISIAFVFYITATTGTG
TMPFGMAKLVGGICFSLGLILCVVCGADLFTSTVLIVVAKASGRITWGQLAKNWLNVYFG
NLVGALLFVLLMWLSGEYMTANGQWGLNVLQTADHKVHHTFIEAVCLGILANLMVCLAVW
MSYSGRSLMDKAFIMVLPVAMFVASGFEHSIANMFMIPMGIVIRDFASPEFWTAVGSAPE
NFSHLTVMNFITDNLIPVTIGNIIGGGLLVGLTYWVIYLRENDHH
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctgacaacccttttgatcttttacttcctgctgcaatggccaaagtggccgaa
gaggcgggtgtctataaagcaacgaaacatccgcttaagactttctatctggcgattacc
gccggtgttttcatctcaatcgcattcgtcttctatatcacagcaaccactggcacaggc
acaatgcccttcggcatggcaaaactggttggcggcatttgcttctctctggggctgatt
ctttgtgttgtctgcggagccgatctctttacttccaccgtgttgattgttgttgctaag
gcgagtgggcgcatcacctggggtcagttggcgaaaaactggctaaatgtctattttggc
aacctggtcggcgcactgctgtttgtacttttaatgtggctttccggcgagtatatgacc
gcaaatggtcaatggggactaaacgtcctacaaaccgccgaccacaaagtgcaccatact
tttattgaggccgtctgtcttggtatcctggcaaacctgatggtatgtctggcagtatgg
atgagttattctggccgcagcctgatggacaaagcgttcattatggtgctgccggtcgcg
atgtttgttgccagcggttttgagcacagtatcgcaaacatgtttatgatcccgatgggt
attgtaatccgcgacttcgcatccccggaattttggaccgcagtcggttctgcaccggaa
aatttttctcacctgaccgtgatgaatttcatcactgataacctgattccggttacgatc
ggcaacattatcggtggtggtttgttggttgggttgacatactgggtcatttacctgcgt
gaaaacgaccaccattaa

DBGET integrated database retrieval system