KEGG   Escherichia coli K-12 MG1655: b0908Help
Entry
b0908             CDS       T00007                                 

Gene name
aroA
Definition
(RefSeq) 5-enolpyruvylshikimate-3-phosphate synthetase (EC:2.5.1.19)
  KO
K00800  
3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    b0908 (aroA)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    b0908 (aroA)
Enzymes [BR:eco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     b0908 (aroA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
958812..960095
Genome map
AA seq 427 aa AA seqDB search
MESLTLQPIARVDGTINLPGSKSVSNRALLLAALAHGKTVLTNLLDSDDVRHMLNALTAL
GVSYTLSADRTRCEIIGNGGPLHAEGALELFLGNAGTAMRPLAAALCLGSNDIVLTGEPR
MKERPIGHLVDALRLGGAKITYLEQENYPPLRLQGGFTGGNVDVDGSVSSQFLTALLMTA
PLAPEDTVIRIKGDLVSKPYIDITLNLMKTFGVEIENQHYQQFVVKGGQSYQSPGTYLVE
GDASSASYFLAAAAIKGGTVKVTGIGRNSMQGDIRFADVLEKMGATICWGDDYISCTRGE
LNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGAEVE
EGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQL
ARISQAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaatccctgacgttacaacccatcgctcgtgtcgatggcactattaatctgcccggt
tccaagagcgtttctaaccgcgctttattgctggcggcattagcacacggcaaaacagta
ttaaccaatctgctggatagcgatgacgtgcgccatatgctgaatgcattaacagcgtta
ggggtaagctatacgctttcagccgatcgtacgcgttgcgaaattatcggtaacggcggt
ccattacacgcagaaggtgccctggagttgttcctcggtaacgccggaacggcaatgcgt
ccgctggcggcagctctttgtctgggtagcaatgatattgtgctgaccggtgagccgcgt
atgaaagaacgcccgattggtcatctggtggatgcgctgcgcctgggcggggcgaagatc
acttacctggaacaagaaaattatccgccgttgcgtttacagggcggctttactggcggc
aacgttgacgttgatggctccgtttccagccaattcctcaccgcactgttaatgactgcg
cctcttgcgccggaagatacggtgattcgtattaaaggcgatctggtttctaaaccttat
atcgacatcacactcaatctgatgaagacgtttggtgttgaaattgaaaatcagcactat
caacaatttgtcgtaaaaggcgggcagtcttatcagtctccgggtacttatttggtcgaa
ggcgatgcatcttcggcttcttactttctggcagcagcagcaatcaaaggcggcactgta
aaagtgaccggtattggacgtaacagtatgcagggtgatattcgctttgctgatgtgctg
gaaaaaatgggcgcgaccatttgctggggcgatgattatatttcctgcacgcgtggtgaa
ctgaacgctattgatatggatatgaaccatattcctgatgcggcgatgaccattgccacg
gcggcgttatttgcaaaaggcaccaccacgctgcgcaatatctataactggcgtgttaaa
gagaccgatcgcctgtttgcgatggcaacagaactgcgtaaagtcggcgcggaagtggaa
gaggggcacgattacattcgtatcactcctccggaaaaactgaactttgccgagatcgcg
acatacaatgatcaccggatggcgatgtgtttctcgctggtggcgttgtcagatacacca
gtgacgattcttgatcccaaatgcacggccaaaacatttccggattatttcgagcagctg
gcgcggattagccaggcagcctga

DBGET integrated database retrieval system