KEGG   Escherichia coli K-12 MG1655: b0911Help
Entry
b0911             CDS       T00007                                 

Gene name
rpsA
Definition
(RefSeq) 30S ribosomal subunit protein S1
  KO
K02945  
small subunit ribosomal protein S1
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    b0911 (rpsA)
Ribosome [BR:eco03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    b0911 (rpsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
961995..963668
Genome map
AA seq 557 aa AA seqDB search
MTESFAQLFEESLKEIETRPGSIVRGVVVAIDKDVVLVDAGLKSESAIPAEQFKNAQGEL
EIQVGDEVDVALDAVEDGFGETLLSREKAKRHEAWITLEKAYEDAETVTGVINGKVKGGF
TVELNGIRAFLPGSLVDVRPVRDTLHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENSA
ERDQLLENLQEGMEVKGIVKNLTDYGAFVDLGGVDGLLHITDMAWKRVKHPSEIVNVGDE
ITVKVLKFDRERTRVSLGLKQLGEDPWVAIAKRYPEGTKLTGRVTNLTDYGCFVEIEEGV
EGLVHVSEMDWTNKNIHPSKVVNVGDVVEVMVLDIDEERRRISLGLKQCKANPWQQFAET
HNKGDRVEGKIKSITDFGIFIGLDGGIDGLVHLSDISWNVAGEEAVREYKKGDEIAAVVL
QVDAERERISLGVKQLAEDPFNNWVALNKKGAIVTGKVTAVDAKGATVELADGVEGYLRA
SEASRDRVEDATLVLSVGDEVEAKFTGVDRKNRAISLSVRAKDEADEKDAIATVNKQEDA
NFSNNAMAEAFKAAKGE
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatcttttgctcaactctttgaagagtccttaaaagaaatcgaaacccgcccg
ggttctatcgttcgtggcgttgttgttgctatcgacaaagacgtagtactggttgacgct
ggtctgaaatctgagtccgccatcccggctgagcagttcaaaaacgcccagggcgagctg
gaaatccaggtaggtgacgaagttgacgttgctctggacgcagtagaagacggcttcggt
gaaactctgctgtcccgtgagaaagctaaacgtcacgaagcctggatcacgctggaaaaa
gcttacgaagatgctgaaactgttaccggtgttatcaacggcaaagttaagggcggcttc
actgttgagctgaacggtattcgtgcgttcctgccaggttctctggtagacgttcgtccg
gtgcgtgacactctgcacctggaaggcaaagagcttgaatttaaagtaatcaagctggat
cagaagcgcaacaacgttgttgtttctcgtcgtgccgttatcgaatccgaaaacagcgca
gagcgcgatcagctgctggaaaacctgcaggaaggcatggaagttaaaggtatcgttaag
aacctcactgactacggtgcattcgttgatctgggcggcgttgacggcctgctgcacatc
actgacatggcctggaaacgcgttaagcatccgagcgaaatcgtcaacgtgggcgacgaa
atcactgttaaagtgctgaagttcgaccgcgaacgtacccgtgtatccctgggcctgaaa
cagctgggcgaagatccgtgggtagctatcgctaaacgttatccggaaggtaccaaactg
actggtcgcgtgaccaacctgaccgactacggctgcttcgttgaaatcgaagaaggcgtt
gaaggcctggtacacgtttccgaaatggactggaccaacaaaaacatccacccgtccaaa
gttgttaacgttggcgatgtagtggaagttatggttctggatatcgacgaagaacgtcgt
cgtatctccctgggtctgaaacagtgcaaagctaacccgtggcagcagttcgcggaaacc
cacaacaagggcgaccgtgttgaaggtaaaatcaagtctatcactgacttcggtatcttc
atcggcttggacggcggcatcgacggcctggttcacctgtctgacatctcctggaacgtt
gcaggcgaagaagcagttcgtgaatacaaaaaaggcgacgaaatcgctgcagttgttctg
caggttgacgcagaacgtgaacgtatctccctgggcgttaaacagctcgcagaagatccg
ttcaacaactgggttgctctgaacaagaaaggcgctatcgtaaccggtaaagtaactgca
gttgacgctaaaggcgcaaccgtagaactggctgacggcgttgaaggttacctgcgtgct
tctgaagcatcccgtgaccgcgttgaagacgctaccctggttctgagcgttggcgacgaa
gttgaagctaaattcaccggcgttgatcgtaaaaaccgcgcaatcagcctgtctgttcgt
gcgaaagacgaagctgacgagaaagatgcaatcgcaactgttaacaaacaggaagatgca
aacttctccaacaacgcaatggctgaagctttcaaagcagctaaaggcgagtaa

DBGET integrated database retrieval system