KEGG   Escherichia coli K-12 MG1655: b0914Help
Entry
b0914             CDS       T00007                                 

Gene name
msbA
Definition
(RefSeq) fused lipid transporter subunits of ABC superfamily: membrane component/ATP-binding component
  KO
K11085  
ATP-binding cassette, subfamily B, bacterial MsbA [EC:3.6.3.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0914 (msbA)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     b0914 (msbA)
Transporters [BR:eco02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    b0914 (msbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
966621..968369
Genome map
AA seq 582 aa AA seqDB search
MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTD
RSVLVWMPLVVIGLMILRGITSYVSSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQS
TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSI
AIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNRMRLQ
GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS
LTNVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIERATGDVEFRNVTFTYPGRDVPALR
NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVA
LVSQNVHLFNDTVANNIAYARTEQYSREQIEEAARMAYAMDFINKMDNGLDTVIGENGVL
LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS
TIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgcataacgacaaagatctctctacgtggcagacattccgccgactgtggccaaccatt
gcgcctttcaaagcgggtctgatcgtggcgggcgtagcgttaatcctcaacgcagccagc
gataccttcatgttatcgctccttaagccacttcttgatgatggctttggtaaaacagat
cgctccgtgctggtgtggatgccgctggtggtgatcgggctgatgattttacgtggtatc
accagctatgtctccagctactgtatctcctgggtatcaggaaaggtggtaatgaccatg
cgtcgccgcctgtttggtcacatgatgggaatgccagtttcattctttgacaaacagtca
acgggtacgctgttgtcacgtattacctacgattccgaacaggttgcttcttcttcttcc
ggcgcactgattactgttgtgcgtgaaggtgcgtcgatcatcggcctgttcatcatgatg
ttctattacagttggcaactgtcgatcattttgattgtgctggcaccgattgtttcgatt
gcgattcgcgttgtatcgaagcgttttcgcaacatcagtaaaaacatgcagaacaccatg
gggcaggtgaccaccagcgcagaacaaatgctgaagggccacaaagaagtattgattttc
ggtggtcaggaagtggaaacgaaacgctttgataaagtcagcaaccgaatgcgtcttcag
gggatgaaaatggtttcagcctcttccatctctgatccgatcattcagctgatcgcctct
ttggcgctggcgtttgttctgtatgcggcgagcttcccaagtgtcatggatagcctgact
gccggtacgattaccgttgttttctcttcaatgattgcactgatgcgtccgctgaaatcg
ctgaccaacgttaacgcccagttccagcgcggtatggcggcttgtcagacgctgtttacc
attctggacagtgagcaggagaaagatgaaggtaagcgcgtgatcgagcgtgcgactggc
gacgtggaattccgcaatgtcacctttacttatccgggacgtgacgtacctgcattgcgt
aacatcaacctgaaaattccggcagggaagacggttgctctggttggacgctctggttcg
ggtaaatcaaccatcgccagcctgatcacgcgtttttacgatattgatgaaggcgaaatc
ctgatggatggtcacgatctgcgcgagtataccctggcgtcgttacgtaaccaggttgct
ctggtgtcgcagaatgtccatctgtttaacgatacggttgctaacaacattgcttacgca
cggactgaacagtacagccgtgagcaaattgaagaagcggcgcgtatggcctacgccatg
gacttcatcaataagatggataacggtctcgatacagtgattggtgaaaacggcgtgctg
ctctctggcggtcagcgtcagcgtattgctatcgctcgagccttgttgcgtgatagcccg
attctgattctggacgaagctacctcggctctggataccgaatccgaacgtgcgattcag
gcggcactggatgagttgcagaaaaaccgtacctctctggtgattgcccaccgcttgtct
accattgaaaaggcagacgaaatcgtggtcgtcgaggatggtgtcattgtggaacgcggt
acgcataacgatttgcttgagcaccgcggcgtttacgcgcaacttcacaaaatgcagttt
ggccaatga

DBGET integrated database retrieval system