KEGG   Escherichia coli K-12 MG1655: b0915Help
Entry
b0915             CDS       T00007                                 

Gene name
lpxK
Definition
(RefSeq) lipid A 4'kinase (EC:2.7.1.130)
  KO
K00912  
tetraacyldisaccharide 4'-kinase [EC:2.7.1.130]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
Lipopolysaccharide biosynthesis, KDO2-lipid A
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    b0915 (lpxK)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.130  tetraacyldisaccharide 4'-kinase
     b0915 (lpxK)
Lipopolysaccharide biosynthesis proteins [BR:eco01005]
 Lipid A
  b0915 (lpxK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
968366..969352
Genome map
AA seq 328 aa AA seqDB search
MIEKIWSGESPLWRLLLPLSWLYGLVSGAIRLCYKLKLKRAWRAPVPVVVVGNLTAGGNG
KTPVVVWLVEQLQQRGIRVGVVSRGYGGKAESYPLLLSADTTTAQAGDEPVLIYQRTDAP
VAVSPVRSDAVKAILAQHPDVQIIVTDDGLQHYRLARDVEIVVIDGVRRFGNGWWLPAGP
MRERAGRLKSVDAVIVNGGVPRSGEIPMHLLPGQAVNLRTGTRCDVAQLEHVVAMAGIGH
PPRFFATLKMCGVQPEKCVPLADHQSLNHADVSALVSAGQTLVMTEKDAVKCRAFAEENW
WYLPVDAQLSGDEPAKLLTQLTLLASGN
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaaaaatctggtctggtgaatcccctttgtggcggctattgctgccactctcc
tggttgtatggcctggtgagtggcgcgatccgtctttgctataaactaaaactgaagcgc
gcctggcgtgcccccgtaccggttgtcgtggttggtaatctcaccgcaggcggcaacgga
aaaaccccggtcgttgtctggctggtggaacagttgcaacagcgcggtattcgcgtgggg
gtcgtatcgcggggatatggtggtaaggctgaatcttatccgctgttattgtcggcagat
accacaacagcacaggcgggtgatgaacctgtgttgatttatcaacgcactgatgcgcct
gttgcggtttctcccgttcgttctgatgcggtaaaagccattctggcgcaacaccctgat
gtgcagatcatcgtaaccgacgacggtttacagcattaccgtctggcgcgtgatgtggaa
attgtcgttattgatggtgtgcgtcgctttggcaatggctggtggttgccggcggggcca
atgcgtgagcgagcggggcgcttaaagtcggttgatgcggtaatcgtcaacggcggtgtc
cctcgcagcggtgaaatccccatgcatctgctgccgggtcaggcggtgaatttacgtacc
ggtacgcgttgtgacgttgctcagcttgaacatgtagtggcgatggcggggattgggcat
ccgccgcgcttttttgccacgctgaagatgtgtggcgtacaaccggaaaaatgtgtaccg
ctggccgatcatcagtctttgaaccatgcggatgtcagtgcgttggtaagcgccgggcaa
acgctggtaatgactgaaaaagatgcggtgaaatgccgggcctttgcagaagaaaattgg
tggtatttgcctgtagacgcacagctttcaggtgatgaaccagcgaaactgcttacgcaa
ctaaccttgctggcttctggcaactag

DBGET integrated database retrieval system