KEGG   Escherichia coli K-12 MG1655: b0929Help
Entry
b0929             CDS       T00007                                 

Gene name
ompF
Definition
(RefSeq) outer membrane porin 1a (Ia;b;F)
  KO
K09476  
outer membrane pore protein F
Organism
eco  Escherichia coli K-12 MG1655
Pathway
beta-Lactam resistance
Two-component system
Module
Multidrug resistance, repression of porin OmpF
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b0929 (ompF)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    b0929 (ompF)
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b0929 (ompF)
Antimicrobial resistance genes [BR:eco01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, repression of porin OmpF [MD:M00746]
    b0929 (ompF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(985894..986982)
Genome map
AA seq 362 aa AA seqDB search
MMKRNILAVIVPALLVAGTANAAEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDM
TYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDY
GRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYL
GKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGL
KYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKS
KAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVY
QF
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcgcaatattctggcagtgatcgtccctgctctgttagtagcaggtactgca
aacgctgcagaaatctataacaaagatggcaacaaagtagatctgtacggtaaagctgtt
ggtctgcattatttttccaagggtaacggtgaaaacagttacggtggcaatggcgacatg
acctatgcccgtcttggttttaaaggggaaactcaaatcaattccgatctgaccggttat
ggtcagtgggaatataacttccagggtaacaactctgaaggcgctgacgctcaaactggt
aacaaaacgcgtctggcattcgcgggtcttaaatacgctgacgttggttctttcgattac
ggccgtaactacggtgtggtttatgatgcactgggttacaccgatatgctgccagaattt
ggtggtgatactgcatacagcgatgacttcttcgttggtcgtgttggcggcgttgctacc
tatcgtaactccaacttctttggtctggttgatggcctgaacttcgctgttcagtacctg
ggtaaaaacgagcgtgacactgcacgccgttctaacggcgacggtgttggcggttctatc
agctacgaatacgaaggctttggtatcgttggtgcttatggtgcagctgaccgtaccaac
ctgcaagaagctcaacctcttggcaacggtaaaaaagctgaacagtgggctactggtctg
aagtacgacgcgaacaacatctacctggcagcgaactacggtgaaacccgtaacgctacg
ccgatcactaataaatttacaaacaccagcggcttcgccaacaaaacgcaagacgttctg
ttagttgcgcaataccagttcgatttcggtctgcgtccgtccatcgcttacaccaaatct
aaagcgaaagacgtagaaggtatcggtgatgttgatctggtgaactactttgaagtgggc
gcaacctactacttcaacaaaaacatgtccacctatgttgactacatcatcaaccagatc
gattctgacaacaaactgggcgtaggttcagacgacaccgttgctgtgggtatcgtttac
cagttctaa

DBGET integrated database retrieval system