KEGG   Escherichia coli K-12 MG1655: b0932Help
Entry
b0932             CDS       T00007                                 

Gene name
pepN
Definition
(RefSeq) aminopeptidase N (EC:3.4.11.2)
  KO
K01256  
aminopeptidase N [EC:3.4.11.2]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Glutathione metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    b0932 (pepN)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.2  membrane alanyl aminopeptidase
     b0932 (pepN)
Peptidases [BR:eco01002]
 Metallo Peptidases
  Family M1
   b0932 (pepN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
990622..993234
Genome map
AA seq 870 aa AA seqDB search
MTQQPQAKYRHDYRAPDYQITDIDLTFDLDAQKTVVTAVSQAVRHGASDAPLRLNGEDLK
LVSVHINDEPWTAWKEEEGALVISNLPERFTLKIINEISPAANTALEGLYQSGDALCTQC
EAEGFRHITYYLDRPDVLARFTTKIIADKIKYPFLLSNGNRVAQGELENGRHWVQWQDPF
PKPCYLFALVAGDFDVLRDTFTTRSGREVALELYVDRGNLDRAPWAMTSLKNSMKWDEER
FGLEYDLDIYMIVAVDFFNMGAMENKGLNIFNSKYVLARTDTATDKDYLDIERVIGHEYF
HNWTGNRVTCRDWFQLSLKEGLTVFRDQEFSSDLGSRAVNRINNVRTMRGLQFAEDASPM
AHPIRPDMVIEMNNFYTLTVYEKGAEVIRMIHTLLGEENFQKGMQLYFERHDGSAATCDD
FVQAMEDASNVDLSHFRRWYSQSGTPIVTVKDDYNPETEQYTLTISQRTPATPDQAEKQP
LHIPFAIELYDNEGKVIPLQKGGHPVNSVLNVTQAEQTFVFDNVYFQPVPALLCEFSAPV
KLEYKWSDQQLTFLMRHARNDFSRWDAAQSLLATYIKLNVARHQQGQPLSLPVHVADAFR
AVLLDEKIDPALAAEILTLPSVNEMAELFDIIDPIAIAEVREALTRTLATELADELLAIY
NANYQSEYRVEHEDIAKRTLRNACLRFLAFGETHLADVLVSKQFHEANNMTDALAALSAA
VAAQLPCRDALMQEYDDKWHQNGLVMDKWFILQATSPAANVLETVRGLLQHRSFTMSNPN
RIRSLIGAFAGSNPAAFHAEDGSGYLFLVEMLTDLNSRNPQVASRLIEPLIRLKRYDAKR
QEKMRAALEQLKGLENLSGDLYEKITKALA
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacagccacaagccaaataccgtcacgattatcgtgcgccggattaccagatt
actgatattgacttgacctttgacctcgacgcgcaaaagacggtcgttaccgcggtcagc
caggctgtccgtcatggtgcatcagatgctccccttcgtctcaacggcgaagacctcaaa
ctggtttctgttcatattaatgatgagccgtggaccgcctggaaagaagaagagggcgca
ctggttatcagtaatttgccggagcgttttacgcttaagatcattaatgaaataagcccg
gcggcgaataccgcgctggaagggctttatcagtcaggcgatgcgctttgcacccagtgt
gaagccgaaggtttccgccatattacgtattatctcgaccgcccggacgtgctggcgcgt
tttaccaccaaaattattgccgataaaatcaaatatcccttcctgctttccaatggtaac
cgcgttgcgcaaggcgaactggaaaacggacgccattgggtacagtggcaggacccgttc
ccgaaaccgtgctacctgtttgcgctggtggcaggcgactttgatgtactgcgcgatacc
tttaccacgcgttctggtcgcgaagtagcactggagctgtacgtcgatcgcggcaacctt
gatcgcgcgccgtgggcgatgacctcgctgaaaaactccatgaaatgggatgaagaacgc
tttggcctggagtatgacctcgacatctatatgatcgtcgcggtggatttcttcaatatg
ggcgcaatggagaataaggggctgaatatctttaactccaaatatgtgctggcccgcacc
gacaccgccaccgacaaagattacctcgatattgaacgcgttatcggccatgaatatttc
cataactggaccggtaaccgagtgacctgtcgcgactggttccagctcagcctgaaagaa
ggtttaaccgtcttccgcgatcaggagttcagctctgaccttggttcccgcgcagttaac
cgcatcaataatgtacgcaccatgcgcggattgcagtttgcagaagacgccagcccgatg
gcgcacccgatccgcccggatatggtcattgagatgaacaacttctacaccctgaccgtt
tacgagaagggcgcggaagtgattcgcatgatccacaccctgcttggcgaagaaaacttc
cagaaagggatgcagctttatttcgagcgtcatgatggtagtgcagcgacctgtgacgac
tttgtgcaggcgatggaagatgcgtcgaatgtcgatctctcccatttccgccgttggtac
agccagtccggtacaccgattgtgaccgtcaaagacgactacaatccggaaaccgagcag
tacaccctgaccatcagccagcgcacgccagccacgccggatcaggcagaaaaacagccg
ctgcatattccgtttgccatcgaactgtatgataacgaaggcaaagtgatcccgttgcag
aaaggcggtcatccggtgaattccgtgctgaacgtcactcaggcggaacagacctttgtc
tttgataatgtctacttccagccggtgcctgcgctgctgtgcgaattctctgcgccagtg
aaactggaatataagtggagcgatcagcaactgaccttcctgatgcgtcatgcgcgtaat
gatttctcccgctgggatgcggcgcaaagtttgctggcaacctacatcaagctgaacgtc
gcgcgtcatcagcaaggtcagccgctgtctctgccggtgcatgtggctgatgctttccgc
gcggtactgcttgatgagaagattgatccagcgctggcggcagaaatcctgacgctgcct
tctgtcaatgaaatggctgaattgttcgatatcatcgacccgattgctattgccgaagta
cgcgaagcactcactcgtactctggcgactgaactggcggatgagctactggctatttac
aacgcgaattaccagagcgagtaccgtgttgagcatgaagatattgcaaaacgcactctg
cgtaatgcctgcctgcgtttcctcgcttttggtgaaacgcatctggctgatgtgctggtg
agcaagcagttccacgaagcaaacaatatgactgatgcgctggcggcgctttctgcggcg
gttgccgcacagctgccttgccgtgacgcgctgatgcaggagtacgacgacaagtggcat
cagaacggtctggtgatggataaatggtttatcctgcaagccaccagcccggcggcgaat
gtgctggagacggtgcgcggcctgttgcagcatcgctcatttaccatgagcaacccgaac
cgtattcgttcgttgattggcgcgtttgcgggcagcaatccggcagcgttccatgccgaa
gatggcagcggttacctgttcctggtggaaatgcttaccgacctcaacagccgtaacccg
caggtggcttcacgtctgattgaaccgctgattcgcctgaaacgttacgatgccaaacgt
caggagaaaatgcgcgcggcgctggaacagttgaaagggctggaaaatctctctggcgat
ctgtacgagaagataactaaagcactggcttga

DBGET integrated database retrieval system