KEGG   Escherichia coli K-12 MG1655: b0934Help
Entry
b0934             CDS       T00007                                 

Gene name
ssuC
Definition
(RefSeq) putative alkanesulfonate transporter subunit
  KO
K15554  
sulfonate transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Sulfur metabolism
ABC transporters
Module
Sulfonate transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    b0934 (ssuC)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0934 (ssuC)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfonate transporter [MD:M00436]
    b0934 (ssuC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(994041..994832)
Genome map
AA seq 263 aa AA seqDB search
MATPVKKWLLRVAPWFLPVGIVAVWQLASSVGWLSTRILPSPEGVVTAFWTLSASGELWQ
HLAISSWRALIGFSIGGSLGLILGLISGLSRWGERLLDTSIQMLRNVPHLALIPLVILWF
GIDESAKIFLVALGTLFPIYINTWHGIRNIDRGLVEMARSYGLSGIPLFIHVILPGALPS
IMVGVRFALGLMWLTLIVAETISANSGIGYLAMNAREFLQTDVVVVAIILYALLGKLADV
SAQLLERLWLRWNPAYHLKEATV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgccagtgaagaagtggttattgcgcgttgccccctggtttttaccggtgggc
atcgtggcggtgtggcaactggcctcctcggttggctggctgtcgacgcgtattttgcct
tcaccggaaggagtggtgacggcgttctggacgctctccgccagcggcgaactgtggcag
catctggcgatcagctcctggcgggcgctgattggcttttcaattggcggatcgctgggg
ttgattttgggactgattagcgggctatctcgctggggagaacggctgctggatacctca
attcagatgttgcgcaacgtgccgcatctggcgctgatcccgctggtgattttgtggttt
ggcattgatgaatccgcaaaaatctttctggtggcgctcggtacgctattccccatttat
atcaacacctggcatggcatccgtaatatcgatcgcgggttggtggagatggcgcgtagc
tatggattatccggcataccgctgtttatccatgtgatcctgcctggtgccctgccctca
attatggtcggcgtgcgttttgcgttgggcctgatgtggctgacgctgattgttgccgaa
accatttctgccaattcaggcattggttatctggcgatgaatgcgcgggagtttttgcaa
acggacgtggtggtagtcgctattattctttacgccctgctcggcaaactggctgacgtc
agcgcgcagctgttagagcgcctctggttgcgctggaacccggcttatcatttgaaggag
gccacggtatga

DBGET integrated database retrieval system