KEGG   Escherichia coli K-12 MG1655: b0981Help
Entry
b0981             CDS       T00007                                 

Gene name
etk
Definition
(RefSeq) tyrosine-protein kinase, role in O-antigen capsule formation
  KO
K16692  tyrosine-protein kinase Etk/Wzc [EC:2.7.10.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.-  
     b0981 (etk)
Protein kinases [BR:eco01001]
 Non-receptor tyrosine kinases
  Bacterial
   b0981 (etk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GNVR Wzz AAA_31 AAA_26 CbiA AAA_25 ParA SRP54 LMBR1 Tup_N Occludin_ELL Exonuc_VII_L
Motif
Other DBs
NCBI-GeneID: 947409
NCBI-ProteinID: NP_415501
Pasteur: yccC
RegulonDB: ECK120001758
ECOCYC: EG11826
ASAP: ABE-0003309
UniProt: P38134
Structure
PDB: 

Jmol
Position
complement(1042030..1044210)
Genome map
AA seq 726 aa AA seqDB search
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADT
LVQVEQKQGNAILSGLSDMIPNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPI
VGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGENGHYTLEGEEFTVNGMVGQRL
EKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSV
DLNLEAKAVLEQIVNVDNQLNELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNK
RVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDPAVTQPQPV
KPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGAT
PDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKV
IQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVV
GRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgacaactaaaaatatgaatacgccaccaggcagcactcaggaaaatgagatcgatctg
cttcgtctggtcggcgagttatgggatcaccgtaagtttattatcagcgtgaccgcgtta
ttcacgctgatcgctgtcgcttactcgctgttaagcacaccaatttatcaggcagatact
ctggtccaggttgagcaaaaacagggcaacgccattctcagcggcctgagcgatatgatc
cctaactcatcgcccgagtctgcaccggagatccaactgctgcaatcgcgcatgattctc
ggtaaaaccattgctgaactgaatctgcgcgacatagttgagcagaagtattttccgatt
gtgggtcgcggctgggcgagattaaccaaagaaaaaccaggtgagctggcgatcagctgg
atgcatattccacaactgaatggtcaggatcagcaactgacactcacggttggggaaaac
ggccactatacactggaaggtgaagagttcaccgtcaatggtatggtcggccagcgtctg
gaaaaagatggcgttgcgctgactatcgcggacattaaggccaaaccaggaacacagttt
gtcctgagccagcgtaccgaactggaagcgattaacgcattgcaggaaacctttaccgtt
agcgaacgcagtaaagaaagcgggatgctggaacttaccatgactggtgatgatccccag
ttgattactcgtattctgaacagcatcgctaacaactatttgcaacagaatatcgctcgc
caggcggcgcaggattcacaaagccttgaattcttacagcgccagttacctgaagtgcgc
agcgagctggaccaagcggaagaaaaactcaacgtttatcgccagcagcgcgattcggtt
gaccttaacctggaagccaaagccgttcttgagcagattgtgaacgttgataatcaactc
aatgagctgaccttccgcgaggcagagatctcccagctgtataagaaagatcacccaact
tatcgtgcgctgctggaaaaacgccagacgctggagcaagaacgcaaacgcctgaataag
cgggtatcggcaatgccttccacccaacaggaagtgttgcgtttaagtcgtgacgtagaa
gcgggccgtgcggtatatctgcaattacttaaccgccagcaggagttgagtatttcgaaa
tccagtgccattggtaacgtgcggattatcgacccggcagtcactcagccgcagccagtg
aaaccgaaaaaagcgttgaacgtggtgcttggttttattcttggcctgtttatttctgtg
ggtgccgtgctggcgcgtgcgatgttgcgtcgtggtgtagaagccccggaacaactggaa
gagcacggcatcagcgtttatgccactatcccaatgtccgagtggctggataaacgcacc
cgtctgcgtaagaaaaatttattttctaatcagcagcgccatcgtactaaaaatatcccc
ttcctggcggtggataacccggcggattctgctgtggaagccgtacgtgcgctacgaacc
agtctgcatttcgctatgatggagacggagaataacattctaatgatcaccggtgcgacg
ccagacagtggtaaaacgtttgtcagttcaactctggcagcggtgatcgcccagtccgat
caaaaagtgttatttattgatgccgacttacgccgtggttattcgcataacctgtttacc
gtgagtaatgaacatggcttgtcggaatatctggcaggtaaagatgagctcaacaaagtg
atccagcattttggcaaaggaggctttgatgtgattactcgcggtcaggtgccacctaac
ccgtctgaactgctgatgcgcgatcggatgcgtcaattactggaatgggcgaacgaccat
tacgatctggtgattgtcgatacgccgccgatgctggcggtgagtgatgccgcggtcgtg
gggcgttctgttggcaccagcctgctggttgcgcgttttggcttgaacaccgccaaagag
gtgagtttgtcaatgcagcgtctggaacaggcaggcgtcaatattaaaggcgctatcctc
aatggtgtgattaaacgcgccagcaccgcttacagttacggctataactattacggttat
agttactccgagaaagagtaa

DBGET integrated database retrieval system