KEGG   Escherichia coli K-12 MG1655: b0982Help
Entry
b0982             CDS       T00007                                 

Gene name
etp
Definition
(RefSeq) O-antigen capsule forming protein-tyrosine-phosphatase; Etk-P dephosphorylase
  KO
K01104  
protein-tyrosine phosphatase [EC:3.1.3.48]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     b0982 (etp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1044230..1044676)
Genome map
AA seq 148 aa AA seqDB search
MAQLKFNSILVVCTGNICRSPIGERLLRKRLPGVKVKSAGVHGLVKHPADATAADVAANH
GVSLEGHAGRKLTAEMARNYDLILAMESEHIAQVTAIAPEVRGKTMLFGQWLEQKEIPDP
YRKSQDAFEHVYGMLERASQEWAKRLSR
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcccaactaaaatttaactcaatcctggtggtttgtaccggcaacatttgccgttcg
cccattggcgagcgcttgctgcgtaaacgtctgccgggcgtaaaagtcaaatcggcaggt
gttcatggtctggtaaaacaccctgcagatgcgacagcggcagatgttgccgctaatcat
ggcgtatctcttgaaggacatgccggacgtaagctcactgctgagatggcacgaaattac
gatctgattctggcaatggagtcggaacatattgctcaggttaccgcaattgctcccgag
gtccgcgggaagacaatgctgtttgggcaatggctggaacagaaagagatcccggatccc
tatcgtaaaagtcaggacgcatttgaacatgtctacggtatgttggagcgcgccagtcag
gaatgggcgaagcgcctcagccggtaa

DBGET integrated database retrieval system