KEGG   Escherichia coli K-12 MG1655: b0986Help
Entry
b0986             CDS       T00007                                 

Gene name
gfcB
Definition
(RefSeq) O-antigen capsule production lipoprotein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1048688..1049332)
Genome map
AA seq 214 aa AA seqDB search
MRPLILSIFALFLAGCTHSQQSMVDTFRASLFDNQDITVADQQIQALPYSTMYLRLNEGQ
RIFVVLGYIEQEQSKWLSQDNAMLVTHNGRLLKTVKLNNNLLEVTNSGQDPLRNALAIKD
GSRWTRDILWSEDNHFRSATLSSTFSFAGLETLNIAGRNVLCNVWQEEVTSTRPEKQWQN
TFWVDSATGQVRQSRQMLGAGVIPVEMTFLKPAP
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccctcttattttatcgattttcgcactatttcttgcgggatgtacgcacagccag
caaagtatggtcgatacatttcgcgccagccttttcgataatcaggatatcaccgtagcg
gatcagcagatccaggcgttgccttattccactatgtatttacgccttaatgaagggcaa
cgaatctttgtggtactgggatatatagaacaagaacaaagcaaatggttatcccaggat
aacgccatgctggttacccacaatggacgtcttttaaaaaccgtcaaacttaataataat
ctgctggaagtgacaaattccgggcaggaccctctgcgtaacgcgctggcaataaaagat
ggcagccgctggacgcgcgatattctctggagtgaagacaaccattttcgctctgcgacc
ctgagttctactttttcctttgctggattagagacgctgaatattgcgggtcgcaatgtg
ctgtgtaatgtctggcaggaagaggtgacttccacgcggccagaaaaacagtggcaaaac
acattctgggtcgattcggctactggccaggttcgtcaaagtcggcaaatgttaggcgca
ggggttattcccgtagaaatgacgtttcttaaacccgcaccatga

DBGET integrated database retrieval system