KEGG   Escherichia coli K-12 MG1655: b1033Help
Entry
b1033             CDS       T00007                                 

Gene name
ghrA
Definition
(RefSeq) glyoxylate/hydroxypyruvate reductase A (EC:1.1.1.79)
  KO
K12972  
glyoxylate/hydroxypyruvate reductase A [EC:1.1.1.79 1.1.1.81]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Glycine, serine and threonine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    b1033 (ghrA)
   00630 Glyoxylate and dicarboxylate metabolism
    b1033 (ghrA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    b1033 (ghrA)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     b1033 (ghrA)
    1.1.1.81  hydroxypyruvate reductase
     b1033 (ghrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1097886..1098824
Genome map
AA seq 312 aa AA seqDB search
MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAV
FALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQ
QNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAG
REELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAAL
DSGKVKGAMLDVFNREPLPPESPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGE
RVCGQVDRARGY
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggatatcatcttttatcacccaacgttcgatacccaatggtggattgaggcactgcgc
aaagctattcctcaggcaagagtcagagcatggaaaagcggagataatgactctgctgat
tatgctttagtctggcatcctcctgttgaaatgctggcagggcgcgatcttaaagcggtg
ttcgcactcggggccggtgttgattctattttgagcaagctacaggcacaccctgaaatg
ctgaacccttctgttccactttttcgcctggaagataccggtatgggcgagcaaatgcag
gaatatgctgtcagtcaggtgctgcattggtttcgacgttttgacgattatcgcatccag
caaaatagttcgcattggcaaccgctgcctgaatatcatcgggaagattttaccatcggc
attttgggcgcaggcgtactgggcagtaaagttgctcagagtctgcaaacctggcgcttt
ccgctgcgttgctggagtcgaacccgtaaatcgtggcctggcgtgcaaagctttgccgga
cgggaagaactgtctgcatttctgagccaatgtcgggtattgattaatttgttaccgaat
acccctgaaaccgtcggcattattaatcaacaattactcgaaaaattaccggatggcgcg
tatctcctcaacctggcgcgtggtgttcatgttgtggaagatgacctgctcgcggcgctg
gatagcggcaaagttaaaggcgcaatgttggatgtttttaatcgtgaacccttaccgcct
gaaagtccgctctggcaacatccacgcgtgacgataacaccacatgtcgccgcgattacc
cgtcccgctgaagctgtggagtacatttctcgcaccattgcccagctcgaaaaaggggag
agggtctgcgggcaagtcgaccgcgcacgcggctactaa

DBGET integrated database retrieval system