KEGG   Escherichia coli K-12 MG1655: b1040Help
Entry
b1040             CDS       T00007                                 

Gene name
csgD
Definition
(RefSeq) csgBAC operon transcriptional regulator
  KO
K04333  
LuxR family transcriptional regulator, csgAB operon transcriptional regulatory protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   LuxR family
    b1040 (csgD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1102546..1103196)
Genome map
AA seq 216 aa AA seqDB search
MFNEVHSIHGHTLLLITKSSLQATALLQHLKQSLAITGKLHNIQRSLDDISSGSIILLDM
MEADKKLIHYWQDTLSRKNNNIKILLLNTPEDYPYRDIENWPHINGVFYSMEDQERVVNG
LQGVLRGECYFTQKLASYLITHSGNYRYNSTESALLTHREKEILNKLRIGASNNEIARSL
FISENTVKTHLYNLFKKIAVKNRTQAVSWANDNLRR
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatgaagtccatagtattcatggtcatacattattgttgatcactaaatcttct
ttgcaggcgacagctctcttgcagcaccttaaacaatcgctggcaattacaggaaaatta
cataatattcaacgttctctggacgatatctcttcaggctctattattcttctggatatg
atggaagcggataaaaagcttatccattattggcaggatactttgagcaggaaaaacaac
aatatcaaaatattgttgctaaatacgcctgaagattacccgtaccgcgacattgaaaac
tggcctcatatcaacggcgttttttattccatggaggatcaagaacgtgttgtcaatggg
ttgcaaggcgtcctgcgcggcgaatgctactttacgcaaaagcttgccagctacctgatt
acgcattcaggtaactatcgttataacagcacggaatcagccctccttactcatcgggaa
aaagagatcctgaataagctgcgtatcggcgcgtctaataacgagatcgctcgttcgttg
ttcatcagcgaaaatacggttaaaacgcatctttataatcttttcaagaagatagccgta
aaaaaccggacacaagcggtttcctgggcaaacgataacctcaggcgataa

DBGET integrated database retrieval system