KEGG   Escherichia coli K-12 MG1655: b1047Help
Entry
b1047             CDS       T00007                                 

Gene name
opgC
Definition
(RefSeq) osmoregulated periplasmic glucan succinylation membrane protein
  KO
K11941  
glucans biosynthesis protein C [EC:2.1.-.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.-  Transferring one-carbon groups
    2.1.-.-  
     b1047 (opgC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1107784..1108941)
Genome map
AA seq 385 aa AA seqDB search
MNPVPAQREYFLDSIRAWLMLLGIPFHISLIYSSHTWHVNSAESSLWLTLFNDFIHSFRM
QVFFVISGYFSYMLFLRYPLKKWWKVRVERVGIPMLTAIPLLTLPQFIMLQYVKGKAESW
PGLSLYDKYNTLAWELISHLWFLLVLVVMTTLCVWIFKRIRNNLENSDKTNKKFSMVKLS
VIFLCLGIGYAVIRRTIFIVYPPILSNGMFNFIVMQTLFYLPFFILGALAFIFPHLKALF
TTPSRGCTLAAALAFVAYLLNQRYGSGDAWMYETESVITMVLGLWMVNVVFSFGHRLLNF
QSARVTYFVNASLFIYLVHHPLTLFFGAYITPHITSNWLGFLCGLIFVVGIAIILYEIHL
RIPLLKFLFSGKPVVKRENDKAPAR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacccagtacccgcgcaacgtgaatatttcctcgactccatccgcgcctggctgatg
ttgttagggataccttttcatatttctttaatctattcgagccatacatggcatgtgaat
agcgccgaatcatcattgtggctgaccctttttaatgacttcatccactcgttccgcatg
caggtatttttcgttatatccggctacttttcctacatgctttttttacgctatcccttg
aaaaaatggtggaaagtacgtgtcgaacgtgtaggtatcccgatgttaacagccatcccc
ctactgacattaccgcaatttattatgctgcaatatgtcaaaggaaaagcggaaagttgg
cctgggctgtcattgtatgacaaatataatacgttggcctgggaattaatatcacacctg
tggtttttactggtgttagtggtcatgacgacgctgtgcgtatggatatttaagcgcatc
agaaataatttagaaaattctgataaaacgaataaaaaattctcgatggtaaaactatcg
gtgatttttttatgcctcggcatcggttatgcggtaataagaagaacgatttttattgtg
tatccgcccattctgagtaatggcatgttcaattttattgtcatgcaaacgctgttttat
ttgccgttctttatcctcggcgcactggctttcattttccctcatcttaaagccttgttt
accacgccgtctcgtggctgtacccttgcagcagcattggcgtttgtcgcttatttactc
aaccagcgctatggcagtggcgatgcctggatgtacgaaaccgagtcggtgatcaccatg
gtcctcggtctgtggatggtgaatgtggtcttctcctttggccaccgtttgcttaacttc
cagtcagcgcgggtgacttattttgttaacgcatcgctgtttatctatctggttcaccac
ccgttaacgctgtttttcggcgcatacattacaccgcacatcacctccaactggcttggt
tttctctgtggcctgatatttgtagtagggattgcgataattctgtatgaaattcatttg
cgcatcccgttactgaagtttttgttctctggtaaaccggttgttaagcgtgagaacgat
aaagcaccagcccgttaa

DBGET integrated database retrieval system