KEGG   Escherichia coli K-12 MG1655: b1048Help
Entry
b1048             CDS       T00007                                 

Gene name
opgG
Definition
(RefSeq) osmoregulated periplasmic glucan (OPG) biosynthesis periplasmic protein
  KO
K03670  
periplasmic glucans biosynthesis protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
1109335..1110870
Genome map
AA seq 511 aa AA seqDB search
MMKMRWLSAAVMLTLYTSSSWAFSIDDVAKQAQSLAGKGYETPKSNLPSVFRDMKYADYQ
QIQFNHDKAYWNNLKTPFKLEFYHQGMYFDTPVKINEVTATAVKRIKYSPDYFTFGDVQH
DKDTVKDLGFAGFKVLYPINSKDKNDEIVSMLGASYFRVIGAGQVYGLSARGLAIDTALP
SGEEFPRFKEFWIERPKPTDKRLTIYALLDSPRATGAYKFVVMPGRDTVVDVQSKIYLRD
KVGKLGVAPLTSMFLFGPNQPSPANNYRPELHDSNGLSIHAGNGEWIWRPLNNPKHLAVS
SFSMENPQGFGLLQRGRDFSRFEDLDDRYDLRPSAWVTPKGEWGKGSVELVEIPTNDETN
DNIVAYWTPDQLPEPGKEMNFKYTITFSRDEDKLHAPDNAWVQQTRRSTGDVKQSNLIRQ
PDGTIAFVVDFTGAEMKKLPEDTPVTAQTSIGDNGEIVESTVRYNPVTKGWRLVMRVKVK
DAKKTTEMRAALVNADQTLSETWSYQLPANE
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaatgcgttggttgagtgctgcagtaatgttaaccctgtatacatcttcaagc
tgggctttcagtattgatgatgtcgcaaagcaagctcaatctttagccgggaaaggctac
gagacgcccaaaagcaacttgccctccgttttccgcgatatgaaatacgcggactatcag
cagatccagtttaatcatgacaaagcgtactggaacaatctgaagaccccattcaaactc
gagttctaccatcagggtatgtacttcgataccccggtcaaaataaatgaagtgactgcc
accgcagtcaaacgaatcaaatacagcccggattatttcactttcggcgatgttcagcat
gacaaagatacggtaaaagaccttggctttgccggttttaaagtgctttacccgatcaac
agcaaagataaaaacgatgaaatcgtcagcatgctcggggccagctatttccgcgtgatt
ggtgcaggtcaggtttatggcctttctgcccgcggcctggcaattgataccgccttgcca
tcgggtgaagaatttccgcgcttcaaagagttctggatcgagcgtccaaaaccgactgat
aaacgtttaaccatctatgcattgcttgactcgccgcgtgcgacaggtgcttacaaattc
gtggttatgccagggcgtgacacggttgtggatgtgcagtcgaaaatctatctgcgcgat
aaagtcggcaaactgggggttgcaccgttaaccagtatgttcctgtttgggccgaaccaa
ccgtcgcctgcaaataactatcgtccggagttgcacgactctaacggtctctctatccat
gccggtaatggcgaatggatctggcgtccgttgaataacccgaaacatttagcggtcagc
agcttctccatggaaaacccgcaaggctttggtctgttgcagcgcggtcgtgatttctcc
cgctttgaagatctcgatgatcgttacgatctccgtccaagcgcatgggtgactccgaaa
ggggagtggggtaaaggcagcgttgagctggtggaaattccaaccaacgatgaaaccaac
gataacatcgtcgcttactggacgccggatcagctgccggagccgggtaaagagatgaac
tttaaatacaccatcaccttcagccgtgatgaagacaaactgcatgcgccagataacgca
tgggtgcaacaaacgcgtcgttcaacgggggatgtgaagcagtcgaacctgattcgccag
cctgacggtactatcgcctttgtggtcgattttaccggcgcagagatgaaaaaactgcca
gaggataccccggtcacagcgcaaaccagcattggtgataatggtgagatagttgaaagc
acggtgcgctataacccggttaccaaaggctggcgtctggtgatgcgtgtgaaagtgaaa
gatgccaagaaaaccactgaaatgcgtgctgcgctggtgaatgccgatcagacgttgagt
gaaacctggagctaccagttacctgccaatgaataa

DBGET integrated database retrieval system