KEGG   Escherichia coli K-12 MG1655: b1048Help
Entry
b1048             CDS       T00007                                 

Gene name
opgG
Definition
(RefSeq) OPG biosynthetic periplasmic beta-1,6 branching glycosyltransferase
  KO
K03670  periplasmic glucans biosynthesis protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MdoG
Motif
Other DBs
NCBI-GeneID: 945005
NCBI-ProteinID: NP_415566
Pasteur: mdoG
RegulonDB: ECK120001815
ECOCYC: EG11885
ASAP: ABE-0003558
UniProt: P33136
Structure
PDB: 

Jmol
Position
1109335..1110870
Genome map
AA seq 511 aa AA seqDB search
MMKMRWLSAAVMLTLYTSSSWAFSIDDVAKQAQSLAGKGYETPKSNLPSVFRDMKYADYQ
QIQFNHDKAYWNNLKTPFKLEFYHQGMYFDTPVKINEVTATAVKRIKYSPDYFTFGDVQH
DKDTVKDLGFAGFKVLYPINSKDKNDEIVSMLGASYFRVIGAGQVYGLSARGLAIDTALP
SGEEFPRFKEFWIERPKPTDKRLTIYALLDSPRATGAYKFVVMPGRDTVVDVQSKIYLRD
KVGKLGVAPLTSMFLFGPNQPSPANNYRPELHDSNGLSIHAGNGEWIWRPLNNPKHLAVS
SFSMENPQGFGLLQRGRDFSRFEDLDDRYDLRPSAWVTPKGEWGKGSVELVEIPTNDETN
DNIVAYWTPDQLPEPGKEMNFKYTITFSRDEDKLHAPDNAWVQQTRRSTGDVKQSNLIRQ
PDGTIAFVVDFTGAEMKKLPEDTPVTAQTSIGDNGEIVESTVRYNPVTKGWRLVMRVKVK
DAKKTTEMRAALVNADQTLSETWSYQLPANE
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaatgcgttggttgagtgctgcagtaatgttaaccctgtatacatcttcaagc
tgggctttcagtattgatgatgtcgcaaagcaagctcaatctttagccgggaaaggctac
gagacgcccaaaagcaacttgccctccgttttccgcgatatgaaatacgcggactatcag
cagatccagtttaatcatgacaaagcgtactggaacaatctgaagaccccattcaaactc
gagttctaccatcagggtatgtacttcgataccccggtcaaaataaatgaagtgactgcc
accgcagtcaaacgaatcaaatacagcccggattatttcactttcggcgatgttcagcat
gacaaagatacggtaaaagaccttggctttgccggttttaaagtgctttacccgatcaac
agcaaagataaaaacgatgaaatcgtcagcatgctcggggccagctatttccgcgtgatt
ggtgcaggtcaggtttatggcctttctgcccgcggcctggcaattgataccgccttgcca
tcgggtgaagaatttccgcgcttcaaagagttctggatcgagcgtccaaaaccgactgat
aaacgtttaaccatctatgcattgcttgactcgccgcgtgcgacaggtgcttacaaattc
gtggttatgccagggcgtgacacggttgtggatgtgcagtcgaaaatctatctgcgcgat
aaagtcggcaaactgggggttgcaccgttaaccagtatgttcctgtttgggccgaaccaa
ccgtcgcctgcaaataactatcgtccggagttgcacgactctaacggtctctctatccat
gccggtaatggcgaatggatctggcgtccgttgaataacccgaaacatttagcggtcagc
agcttctccatggaaaacccgcaaggctttggtctgttgcagcgcggtcgtgatttctcc
cgctttgaagatctcgatgatcgttacgatctccgtccaagcgcatgggtgactccgaaa
ggggagtggggtaaaggcagcgttgagctggtggaaattccaaccaacgatgaaaccaac
gataacatcgtcgcttactggacgccggatcagctgccggagccgggtaaagagatgaac
tttaaatacaccatcaccttcagccgtgatgaagacaaactgcatgcgccagataacgca
tgggtgcaacaaacgcgtcgttcaacgggggatgtgaagcagtcgaacctgattcgccag
cctgacggtactatcgcctttgtggtcgattttaccggcgcagagatgaaaaaactgcca
gaggataccccggtcacagcgcaaaccagcattggtgataatggtgagatagttgaaagc
acggtgcgctataacccggttaccaaaggctggcgtctggtgatgcgtgtgaaagtgaaa
gatgccaagaaaaccactgaaatgcgtgctgcgctggtgaatgccgatcagacgttgagt
gaaacctggagctaccagttacctgccaatgaataa

DBGET integrated database retrieval system