KEGG   Escherichia coli K-12 MG1655: b1051Help
Entry
b1051             CDS       T00007                                 

Gene name
msyB
Definition
(RefSeq) multicopy suppressor of secY and secA
  KO
K12147  
acidic protein MsyB
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1113807..1114181)
Genome map
AA seq 124 aa AA seqDB search
MTMYATLEEAIDAAREEFLADNPGIDAEDANVQQFNAQKYVLQDGDIMWQVEFFADEGEE
GECLPMLSGEAAQSVFDGDYDEIEIRQEWQEENTLHEWDEGEFQLEPPLDTEEGRAAADE
WDER
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgtacgcaacgcttgaagaagccattgacgctgcacgcgaagaatttcttgca
gacaaccccggcatcgacgccgaagatgcgaatgtgcaacagttcaatgcccaaaaatac
gttttgcaggacggcgacatcatgtggcaagttgagttttttgccgacgaaggggaagaa
ggtgaatgtttacctatgcttagcggtgaagccgcgcaaagtgtttttgatggcgactat
gatgagatagagatacgccaggagtggcaggaagagaatacattacatgaatgggacgag
ggggaatttcagcttgagccaccgctggataccgaggaaggacgcgcagcagctgatgag
tgggatgaacgttaa

DBGET integrated database retrieval system