KEGG   Escherichia coli K-12 MG1655: b1053Help
Entry
b1053             CDS       T00007                                 

Gene name
mdtG
Definition
(RefSeq) putative drug efflux system protein
  KO
K08161  
MFS transporter, DHA1 family, multidrug resistance protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    b1053 (mdtG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1114264..1115490)
Genome map
AA seq 408 aa AA seqDB search
MSPCENDTPINWKRNLIVAWLGCFLTGAAFSLVMPFLPLYVEQLGVTGHSALNMWSGIVF
SITFLFSAIASPFWGGLADRKGRKLMLLRSALGMGIVMVLMGLAQNIWQFLILRALLGLL
GGFVPNANALIATQVPRNKSGWALGTLSTGGVSGALLGPMAGGLLADSYGLRPVFFITAS
VLILCFFVTLFCIREKFQPVSKKEMLHMREVVTSLKNPKLVLSLFVTTLIIQVATGSIAP
ILTLYVRELAGNVSNVAFISGMIASVPGVAALLSAPRLGKLGDRIGPEKILITALIFSVL
LLIPMSYVQTPLQLGILRFLLGAADGALLPAVQTLLVYNSSNQIAGRIFSYNQSFRDIGN
VTGPLMGAAISANYGFRAVFLVTAGVVLFNAVYSWNSLRRRRIPQVSN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccctgtgaaaatgacacccctataaactggaaacgaaacctgatcgtcgcctgg
ctaggctgttttcttaccggtgccgccttcagtctggtaatgcccttcttacccctctac
gttgagcagcttggcgttaccggtcactccgccctgaatatgtggtccggtattgtcttc
agcattacatttttattttcggccatcgcctcaccgttttggggtggactcgccgaccgt
aaaggccgaaaactcatgctattacgctctgccctcggcatgggcatcgtgatggtgttg
atggggctggcacaaaatatctggcagtttttgatcctgcgggcgcttcttgggttactt
ggcggatttgtccccaacgctaatgctcttatcgccacacaagtaccgcgtaataaaagc
ggctgggcgctgggtacgctctccacaggcggcgttagtggtgcgttgctcggcccaatg
gctggcggcctgctcgccgatagctacggcttacgtccggtattctttattaccgccagt
gtgctcatactctgctttttcgtcaccctgttttgcatcagagaaaaattccagccggtc
agcaaaaaagagatgctgcacatgcgggaagtggtgacatcacttaaaaacccgaaactg
gtactcagcctgtttgtcactacgttaatcatccaggtggcgacgggctcaattgccccc
attctgacgctgtatgtccgcgaactggcgggtaacgtcagtaacgtcgcctttatcagt
ggcatgatcgcctcggtgccaggcgtggcggctctgctaagtgcaccacgactcggcaaa
cttggcgatcgaatcggacccgaaaagatcctgattacagcgctgatcttttctgtactg
ctgttgatcccaatgtcttacgttcagacgccattgcaacttgggattttacgttttttg
ctcggtgccgccgatggtgcactactccccgccgtacagacactgttggtttacaactcg
agcaaccagatcgccgggcgtatcttcagctataaccaatcgtttcgtgatattggcaac
gttaccggaccattgatgggagcagcgatttcagcgaactacggtttcagagcggtattt
ctcgtcaccgctggcgtagtgttattcaacgcagtctattcatggaacagtctacgtcgt
cgtcgaataccccaggtatcgaactga

DBGET integrated database retrieval system