KEGG   Escherichia coli K-12 MG1655: b1069Help
Entry
b1069             CDS       T00007                                 

Gene name
murJ
Definition
(RefSeq) putative peptidoglycan lipid II flippase
  KO
K03980  
putative peptidoglycan lipid II flippase
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    b1069 (murJ)
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b1069 (murJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1127839..1129374
Genome map
AA seq 511 aa AA seqDB search
MNLLKSLAAVSSMTMFSRVLGFARDAIVARIFGAGMATDAFFVAFKLPNLLRRIFAEGAF
SQAFVPILAEYKSKQGEDATRVFVSYVSGLLTLALAVVTVAGMLAAPWVIMVTAPGFADT
ADKFALTSQLLKITFPYILLISLASLVGAILNTWNRFSIPAFAPTLLNISMIGFALFAAP
YFNPPVLALAWAVTVGGVLQLVYQLPHLKKIGMLVLPRINFHDAGAMRVVKQMGPAILGV
SVSQISLIINTIFASFLASGSVSWMYYADRLMEFPSGVLGVALGTILLPSLSKSFASGNH
DEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFDALMTQRALIAYSVG
LIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLILTQLMNLAFIGPLKHAGLSLSIGLAACL
NASLLYWQLRKQKIFTPQPGWMAFLLRLVVAVLVMSGVLLGMLHIMPEWSLGTMPWRLLR
LMAVVLAGIAAYFAALAVLGFKVKEFARRTV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaatttattaaaatcgctggccgccgtcagctcgatgaccatgttttcgcgtgtgctt
ggcttcgcacgagacgcaattgtcgccagaatctttggcgcagggatggcaaccgacgcc
tttttcgtcgcttttaaacttcctaacttgttacgccgtatctttgccgaaggggcattt
tcccaggcatttgtaccgattctggcggaatataaaagtaagcagggtgaagacgccacg
cgggtctttgtctcttatgtttctggcctgctgacacttgcgctggcggttgtgacggtc
gctggcatgctcgccgcaccgtgggtgatcatggtgaccgcgccaggcttcgctgacaca
gctgacaaatttgccctgaccagccagctactaaagattacctttccctatatcttgctg
atctccctggcgtcgctggtgggagcgattctgaatacgtggaaccgcttctcgattccg
gcgtttgctccaacactgcttaacatcagcatgattggtttcgcgctgtttgccgcaccg
tactttaacccaccggtgctggcgctggcgtgggctgttacggtcggcggcgtcctgcag
ctggtgtatcagctaccgcacctgaagaagatcggcatgctggtcctgccgcgcattaac
ttccacgatgccggagcaatgcgcgtggtgaaacagatgggaccggcgatccttggcgtc
tctgtgagccagatctccttaatcatcaacaccatttttgcctcgtttcttgcttccggt
tcggtgtcttggatgtattacgccgaccgcttaatggagtttccgtccggtgtgctgggc
gtggcgcttggcaccattttgctgccgtcgctgtcgaaaagttttgccagtggcaatcat
gatgaatacaaccgtttgatggactgggggttgcgtctttgtttcctgttggcgctgccg
agtgcggttgcgttgggcattctttccggtccgttgaccgtttcgctgttccagtacggt
aaatttaccgcgtttgatgcgctgatgacccagcgggcgttaattgcctactcggtgggt
ttgattggcctgattgtagtgaaagtgttggctcctggcttttattcccgccaggacatt
aaaacgccagtgaaaattgccatcgttacgctgattttaacgcaattgatgaacctggcg
tttattggtccgttgaaacatgccgggctgtcactttctattggtctggcggcgtgtctg
aatgcttcgctgctttactggcagttgcgtaagcagaaaatctttaccccgcaacccggc
tggatggcgtttctgttgcgtctggtggtggcggtactggtgatgtctggcgtgctttta
ggtatgttacatatcatgccggagtggtcattgggtaccatgccctggcgtttactgcgt
ttaatggcggtcgtgctggcggggattgccgcgtacttcgctgcactggcggtactgggc
ttcaaagttaaagaatttgcccgccggacggtgtaa

DBGET integrated database retrieval system