KEGG   Escherichia coli K-12 MG1655: b1079Help
Entry
b1079             CDS       T00007                                 

Gene name
flgH
Definition
(RefSeq) flagellar protein of basal-body outer-membrane L ring
  KO
K02393  
flagellar L-ring protein precursor FlgH
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:eco00001]
 Cellular Processes
  Cell motility
   02040 Flagellar assembly
    b1079 (flgH)
Bacterial motility proteins [BR:eco02035]
 Flagellar system
  Flagellar assembly proteins
   M,S,P and L rings
    b1079 (flgH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
1135564..1136262
Genome map
AA seq 232 aa AA seqDB search
MQKNAAHTYAISSLLVLSLTGCAWIPSTPLVQGATSAQPVPGPTPVANGSIFQSAQPINY
GYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTNFGFDTVPRYLQGLFGNA
RADVEASGGNTFNGKGGANASNTFSGTLTVTVDQVLVNGNLHVVGEKQIAINQGTEFIRF
SGVVNPRTISGSNTVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaacgctgcgcatacttatgccatttccagcttgttggtgctttcactaacc
ggctgcgcctggataccctccacgccgctggtgcagggggcgaccagtgcacaaccggtt
cccggtccgacgcccgtcgccaacggttctattttccagtctgctcagccgattaactat
ggctatcaaccgctgtttgaagatcgtcgaccacgcaatattggcgatacgctgaccatc
gtgttgcaggagaacgtcagcgccagcaaaagctcctctgcgaatgccagccgtgacggt
aaaactaattttggctttgatactgtgccgcgctatttgcaggggctgtttggtaacgct
cgtgccgatgtcgaagcctccggtggtaacacgttcaacggaaagggcggggccaatgcc
agcaatacctttagcggcacgttgacggtgacggttgaccaggtactggtcaacggcaac
ctgcatgtggtgggtgaaaaacagattgccattaatcagggtaccgaatttattcgcttc
tctggcgtggttaatccacgcactatcagcggcagcaataccgtaccgtctactcaggtg
gcggatgcgcgcattgaatacgtaggcaatggctacattaacgaagcgcaaaatatgggc
tggttgcagcgtttcttccttaacctgtcgccaatgtaa

DBGET integrated database retrieval system