KEGG   Escherichia coli K-12 MG1655: b1084Help
Entry
b1084             CDS       T00007                                 

Gene name
rne
Definition
(RefSeq) fused ribonucleaseE: endoribonuclease/RNA-binding protein/RNA degradosome binding protein (EC:3.1.4.-)
  KO
K08300  
ribonuclease E [EC:3.1.26.12]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
RNA degradation
Module
RNA degradosome
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    b1084 (rne)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.12  ribonuclease E
     b1084 (rne)
Messenger RNA biogenesis [BR:eco03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     b1084 (rne)
Ribosome biogenesis [BR:eco03009]
 Prokaryotic Type
  rRNA processing factors
   b1084 (rne)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1141182..1144367)
Genome map
AA seq 1061 aa AA seqDB search
MKRMLINATQQEELRVALVDGQRLYDLDIESPGHEQKKANIYKGKITRIEPSLEAAFVDY
GAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEERGNKGAALTTFI
SLAGSYLVLMPNNPRAGGISRRIEGDDRTELKEALASLELPEGMGLIVRTAGVGKSAEAL
QWDLSFRLKHWEAIKKAAESRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELA
RQHIAALGRPDFSSKIKLYTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALT
AIDINSARATRGGDIEETAFNTNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQRAVE
NRLREAVRQDRARIQISHISRFGLLEMSRQRLSPSLGESSHHVCPRCSGTGTVRDNESLS
LSILRLIEEEALKENTQEVHAIVPVPIASYLLNEKRSAVNAIETRQDGVRCVIVPNDQME
TPHYHVLRVRKGEETPTLSYMLPKLHEEAMALPSEEEFAERKRPEQPALATFAMPDVPPA
PTPAEPAAPVVAPAPKAAPATPAAPAQPGLLSRFFGALKALFSGGEETKPTEQPAPKAEA
KPERQQDRRKPRQNNRRDRNERRDTRSERTEGSDNREENRRNRRQAQQQTAETRESRQQA
EVTEKARTADEQQAPRRERSRRRNDDKRQAQQEAKALNVEEQSVQETEQEERVRPVQPRR
KQRQLNQKVRYEQSVAEEAVVAPVVEETVAAEPIVQEAPAPRTELVKVPLPVVAQTAPEQ
QEENNADNRDNGGMPRRSRRSPRHLRVSGQRRRRYRDERYPTQSPMPLTVACASPELASG
KVWIRYPIVRPQDVQVEEQREQEEVHVQPMVTEVPVAAAIEPVVSAPVVEEVAGVVEAPV
QVAEPQPEVVETTHPEVIAAAVTEQPQVITESDVAVAQEVAEQAEPVVEPQEETADIEEV
VETAEVVVAEPEVVAQPAAPVVAEVAAEVETVAAVEPEVTVEHNHATAPMTRAPAPEYVP
EAPRHSDWQRPTFAFEGKGAAGGHTATHHASAAPARPQPVE
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatgttaatcaacgcaactcagcaggaagagttgcgcgttgcccttgtagat
gggcagcgtctgtatgacctggatatcgaaagtccagggcacgagcagaaaaaggcaaac
atctacaaaggtaaaatcacccgcattgaaccgagtctggaagctgcttttgttgattac
ggcgctgaacgtcacggtttcctcccactaaaagaaattgcccgcgaatatttccctgct
aactacagtgctcatggtcgtcccaacattaaagatgtgttgcgtgaaggtcaggaagtc
attgttcagatcgataaagaagagcgcggcaacaaaggcgcggcattaaccacctttatc
agtctggcgggtagctatctggttctgatgccgaacaacccgcgcgcgggtggcatttct
cgccgtatcgaaggcgacgaccgtaccgaattaaaagaagcactggcaagccttgaactg
ccggaaggcatggggcttatcgtgcgcaccgctggcgtcggcaaatctgctgaggcgctg
caatgggatttaagcttccgtctgaaacactgggaagccatcaaaaaagccgctgaaagc
cgcccggccccgttcctgattcatcaggagagcaacgtaatcgttcgcgcattccgcgat
tacttacgtcaggacatcggcgaaatccttatcgataacccgaaagtgctcgaactggca
cgtcagcatatcgctgcattaggtcgcccggatttcagcagcaaaatcaaactgtacacc
ggcgagatcccgctgttcagccactaccagatcgagtcacagatcgagtccgccttccag
cgtgaagttcgtctgccgtctggtggttccattgttatcgacagcaccgaagcgttaacg
gccatcgacatcaactccgcacgcgcgacccgcggcggcgatatcgaagaaaccgcgttt
aacactaacctcgaagctgccgatgagattgctcgtcagctgcgcctgcgtgacctcggc
ggcctgattgttatcgacttcatcgacatgacgccagtacgccaccagcgtgcggtagaa
aaccgtctgcgtgaagcggtgcgtcaggaccgtgcgcgtattcaaatcagccatatttct
cgctttggcctgctggaaatgtcccgtcagcgcctgagcccatcactgggtgaatccagt
catcacgtttgtccgcgttgttctggtactggcaccgtgcgtgacaacgaatcgctgtcg
ctctctattctgcgtctgatcgaagaagaagcgctgaaagagaacacccaggaagttcac
gccattgttcctgtgccaatcgcttcttacctgctgaatgaaaaacgttctgcggtaaat
gccattgaaactcgtcaggacggtgtgcgctgtgtaattgtgccaaacgatcagatggaa
accccgcactaccacgtgctgcgcgtgcgtaaaggggaagaaaccccaaccttaagctac
atgctgccgaagctgcatgaagaagcgatggcgctgccgtctgaagaagagttcgctgaa
cgtaagcgtccggaacaacctgcgctggcaacctttgccatgccggatgtgccgcctgcg
ccaacgccagctgaacctgccgcgcctgttgtagctccagcaccgaaagctgcaccggca
acaccagcagctcctgcacaacctgggctgttgagccgcttcttcggcgcactgaaagcg
ctgttcagcggtggtgaagaaaccaaaccgaccgagcaaccagcaccgaaagcagaagcg
aaaccggaacgtcaacaggatcgtcgcaagcctcgtcagaacaaccgccgtgaccgtaat
gagcgccgcgacacccgtagtgaacgtactgaaggcagcgataatcgcgaagaaaaccgt
cgtaatcgtcgccaggcacagcagcagactgccgagacgcgtgagagccgtcagcaggct
gaggtaacggaaaaagcgcgtaccgccgacgagcagcaagcgccgcgtcgtgaacgtagc
cgccgccgtaatgatgataaacgtcaggcgcaacaagaagcgaaggcgctgaatgttgaa
gagcaatctgttcaggaaaccgaacaggaagaacgtgtacgtccggttcagccgcgtcgt
aaacagcgtcagctcaatcagaaagtgcgttacgagcaaagcgtagccgaagaagcggta
gtcgcaccggtggttgaagaaactgtcgctgccgaaccaattgttcaggaagcgccagct
ccacgcacagaactggtgaaagtcccgctgccagtcgtagcgcaaactgcaccagaacag
caagaagagaacaatgctgataaccgtgacaacggtggcatgccgcgtcgttctcgccgc
tcgcctcgtcacctgcgcgtaagtggtcagcgtcgtcgtcgctatcgtgacgagcgttat
ccaacccagtcgccaatgccgttgaccgtagcgtgcgcgtctccggaactggcctctggc
aaagtctggatccgctatccaattgtacgtccgcaagatgtacaggttgaagagcagcgc
gaacaggaagaagtacatgtgcagccgatggtgactgaggtccctgtcgccgccgctatc
gaaccggttgttagcgcgccagttgttgaagaagtggccggtgtcgtagaagcccccgtt
caggttgccgaaccgcaaccggaagtggttgaaacgacgcatcctgaagtgatcgctgcc
gcggtaactgaacagccgcaggtgattaccgagtctgatgttgccgtagcccaggaagtt
gcagaacaagcagaaccggtggttgaaccgcaggaagagacggcagatattgaagaagtt
gtcgaaactgctgaggttgtagttgctgaacctgaagttgttgctcaacctgccgcgcca
gtagtcgctgaagtcgcagcagaagttgaaacggtagctgcggtcgaacctgaggtcacc
gttgagcataaccacgctaccgcgccaatgacgcgcgctccagcaccggaatatgttccg
gaggcaccgcgtcacagtgactggcagcgccctacttttgccttcgaaggtaaaggtgcc
gcaggtggtcatacggcaacacatcatgcctctgccgctcctgcgcgtccgcaacctgtt
gagtaa

DBGET integrated database retrieval system