KEGG   Escherichia coli K-12 MG1655: b1101Help
Entry
b1101             CDS       T00007                                 

Gene name
ptsG
Definition
(RefSeq) fused glucose-specific PTS enzymes: IIB component/IIC component (EC:2.7.1.69)
  KO
K02778  
PTS system, glucose-specific IIB component [EC:2.7.1.199]
K02779  
PTS system, glucose-specific IIC component
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Phosphotransferase system (PTS)
Module
PTS system, glucose-specific II component
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    b1101 (ptsG)
   00520 Amino sugar and nucleotide sugar metabolism
    b1101 (ptsG)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    b1101 (ptsG)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.199  protein-Npi-phosphohistidine---D-glucose phosphotransferase
     b1101 (ptsG)
Transporters [BR:eco02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Glucose-specific II component [MD:M00265]
    b1101 (ptsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
1157869..1159302
Genome map
AA seq 477 aa AA seqDB search
MFKNAFANLQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPAVVSHVMAEAGGSVFANMP
LIFAIGVALGFTNNDGVSALAAVVAYGIMVKTMAVVAPLVLHLPAEEIASKHLADTGVLG
GIISGAIAAYMFNRFYRIKLPEYLGFFAGKRFVPIISGLAAIFTGVVLSFIWPPIGSAIQ
TFSQWAAYQNPVVAFGIYGFIERCLVPFGLHHIWNVPFQMQIGEYTNAAGQVFHGDIPRY
MAGDPTAGKLSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPI
EFSFMFVAPILYIIHAILAGLAFPICILLGMRDGTSFSHGLIDFIVLSGNSSKLWLFPIV
GIGYAIVYYTIFRVLIKALDLKTPGREDATEDAKATGTSEMAPALVAAFGGKENITNLDA
CITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRNH
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagaatgcatttgctaacctgcaaaaggtcggtaaatcgctgatgctgccggta
tccgtactgcctatcgcaggtattctgctgggcgtcggttccgcgaatttcagctggctg
cccgccgttgtatcgcatgttatggcagaagcaggcggttccgtctttgcaaacatgcca
ctgatttttgcgatcggtgtcgccctcggctttaccaataacgatggcgtatccgcgctg
gccgcagttgttgcctatggcatcatggttaaaaccatggccgtggttgcgccactggta
ctgcatttacctgctgaagaaatcgcctctaaacacctggcggatactggcgtactcgga
gggattatctccggtgcgatcgcagcgtacatgtttaaccgtttctaccgtattaagctg
cctgagtatcttggcttctttgccggtaaacgctttgtgccgatcatttctggcctggct
gccatctttactggcgttgtgctgtccttcatttggccgccgattggttctgcaatccag
accttctctcagtgggctgcttaccagaacccggtagttgcgtttggcatttacggtttc
atcgaacgttgcctggtaccgtttggtctgcaccacatctggaacgtacctttccagatg
cagattggtgaatacaccaacgcagcaggtcaggttttccacggcgacattccgcgttat
atggcgggtgacccgactgcgggtaaactgtctggtggcttcctgttcaaaatgtacggt
ctgccagctgccgcaattgctatctggcactctgctaaaccagaaaaccgcgcgaaagtg
ggcggtattatgatctccgcggcgctgacctcgttcctgaccggtatcaccgagccgatc
gagttctccttcatgttcgttgcgccgatcctgtacatcatccacgcgattctggcaggc
ctggcattcccaatctgtattcttctggggatgcgtgacggtacgtcgttctcgcacggt
ctgatcgacttcatcgttctgtctggtaacagcagcaaactgtggctgttcccgatcgtc
ggtatcggttatgcgattgtttactacaccatcttccgcgtgctgattaaagcactggat
ctgaaaacgccgggtcgtgaagacgcgactgaagatgcaaaagcgacaggtaccagcgaa
atggcaccggctctggttgctgcatttggtggtaaagaaaacattactaacctcgacgca
tgtattacccgtctgcgcgtcagcgttgctgatgtgtctaaagtggatcaggccggcctg
aagaaactgggcgcagcgggcgtagtggttgctggttctggtgttcaggcgattttcggt
actaaatccgataacctgaaaaccgagatggatgagtacatccgtaaccactaa

DBGET integrated database retrieval system