KEGG   Escherichia coli K-12 MG1655: b1102Help
Entry
b1102             CDS       T00007                                 

Gene name
fhuE
Definition
(RefSeq) ferric-rhodotorulic acid outer membrane transporter
  KO
K16088  
outer-membrane receptor for ferric coprogen and ferric-rhodotorulic acid
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b1102 (fhuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1159362..1161551)
Genome map
AA seq 729 aa AA seqDB search
MLSTQFNRDNQYQAITKPSLLAGCIALALLPSAAFAAPATEETVIVEGSATAPDDGENDY
SVTSTSAGTKMQMTQRDIPQSVTIVSQQRMEDQQLQTLGEVMENTLGISKSQADSDRALY
YSRGFQIDNYMVDGIPTYFESRWNLGDALSDMALFERVEVVRGATGLMTGTGNPSAAINM
VRKHATSREFKGDVSAEYGSWNKERYVADLQSPLTEDGKIRARIVGGYQNNDSWLDRYNS
EKTFFSGIVDADLGDLTTLSAGYEYQRIDVNSPTWGGLPRWNTDGSSNSYDRARSTAPDW
AYNDKEINKVFMTLKQQFADTWQATLNATHSEVEFDSKMMYVDAYVNKADGMLVGPYSNY
GPGFDYVGGTGWNSGKRKVDALDLFADGSYELFGRQHNLMFGGSYSKQNNRYFSSWANIF
PDEIGSFYNFNGNFPQTDWSPQSLAQDDTTHMKSLYAATRVTLADPLHLILGARYTNWRV
DTLTYSMEKNHTTPYAGLVFDINDNWSTYASYTSIFQPQNDRDSSGKYLAPITGNNYELG
LKSDWMNSRLTTTLAIFRIEQDNVAQSTGTPIPGSNGETAYKAVDGTVSKGVEFELNGAI
TDNWQLTFGATRYIAEDNEGNAVNPNLPRTTVKMFTSYRLPVMPELTVGGGVNWQNRVYT
DTVTPYGTFRAEQGSYALVDLFTRYQVTKNFSLQGNVNNLFDKTYDTNVEGSIVYGTPRN
FSITGTYQF
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttcaacacaatttaacagggataatcaatatcaagccatcaccaaaccgtcacta
cttgccggttgcatagcactggcactattaccttctgccgcttttgctgcaccagccact
gaagaaacggtgattgttgagggttcagccacagctccagatgatggcgaaaatgattac
agcgtaacgtctacctctgcgggtaccaaaatgcagatgactcaacgtgatattcctcag
tcggtcactattgttagccagcagcggatggaagatcagcagttacaaacgctgggcgaa
gtgatggaaaacacgctggggatcagcaaaagtcaggcggattccgatcgtgctctttat
tattcccgcggattccagatcgataactatatggttgatggtatccccacctattttgaa
tcgcgctggaatctgggcgacgcactttctgatatggcactctttgaacgcgtagaagta
gtgcgtggcgcgacaggactcatgaccgggacgggtaatccatctgcggcaattaatatg
gttcgaaaacacgcgaccagtcgtgaatttaaaggcgatgtctcggcggaatacggtagc
tggaacaaagaacggtatgtggcggatttacaaagcccactcaccgaagacggtaaaatc
cgcgcgcgaattgtcggcggctaccagaataacgactcatggctggaccgctacaacagt
gaaaagaccttcttctcgggcattgtcgatgctgatttaggcgatcttacgacgctttca
gccggttacgaatatcagcgcattgatgttaatagccctacctggggcggtttaccgcgc
tggaatactgatggcagcagcaacagttacgatcgcgcacgcagtaccgcacctgactgg
gcgtacaacgataaagagatcaacaaggtctttatgaccctgaagcagcagtttgctgat
acctggcaagcgacactgaatgccacccactctgaagtcgaatttgacagcaaaatgatg
tatgtcgatgcctatgtaaacaaagcggatggtatgctggttgggccatacagtaattat
ggacctggctttgattatgtcggcggcaccggttggaacagtggcaaacgtaaagttgat
gcgctggatttgttcgctgacggtagttatgaattgtttggtcgtcagcacaatctaatg
tttggtggcagttacagcaaacaaaacaatcgttacttcagttcatgggccaacatcttc
ccggatgaaattggcagtttctacaactttaatggcaatttcccacaaaccgactggtca
ccacagagcctggcgcaggacgataccacacatatgaaatcgttatatgctgccactcgt
gtcacccttgccgatccgctgcatctgatcctcggcgcacgttataccaactggcgggtt
gatacgctgacttacagcatggagaaaaaccacaccacgccttacgctggtctggtgttt
gacatcaatgacaactggtcgacctacgccagctatacctctattttccagccgcaaaat
gatcgtgacagttcaggcaaatatctggctccaatcaccggtaacaactacgagctgggt
ctgaaatcggactggatgaatagccgtctgaccaccacgttagccatcttccgtattgag
caggataatgtcgctcagtccaccggtacacctatccccggcagcaacggcgaaaccgcc
tataaagcggtggatgggacagtcagtaaaggggtggaatttgaactcaacggcgcaatt
accgacaactggcagctgacatttggcgcaacgcgctatattgcagaggataacgaagga
aacgccgttaatcctaatctgccacgcaccacggttaaaatgttcaccagctatcggttg
cctgtcatgccagagttgacggtcggcggtggtgttaactggcaaaatcgcgtgtatacc
gacaccgtgacgccgtatggcaccttccgcgccgagcaaggtagctacgcgctggtggat
ctcttcacccgctaccaggtgacgaaaaacttctcgttacaggggaacgtcaataacctg
ttcgacaaaacctacgataccaacgtggaaggttctatcgtctacggcacaccgcgtaat
ttcagcattaccggcacgtatcaattctga

DBGET integrated database retrieval system