KEGG   Escherichia coli K-12 MG1655: b1111Help
Entry
b1111             CDS       T00007                                 

Gene name
ycfQ
Definition
(RefSeq) repressor for bhsA(ycfR)
  KO
K22041  
TetR/AcrR family transcriptional regulator, copper-responsive repressor
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   TetR/AcrR family
    b1111 (ycfQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ASAP: 
UniProt: 
Position
complement(1168200..1168832)
Genome map
AA seq 210 aa AA seqDB search
MATDSTQCVKKSRGRPKVFDRDAALDKAMKLFWQHGYEATSLADLVEATGAKAPTLYAEF
TNKEGLFRAVLDRYIDRFAAKHEAQLFCEEKSVESALADYFAAIANCFTSKDTPAGCFMI
NNCTTLSPDSGDIANTLKSRHAMQERTLQQFLCQRQARGEIPPHCDVTHLAEFLNCIIQG
MSISAREGASLEKLMQIAGTTLRLWPELVK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgactcaacacaatgtgtaaaaaaaagccgtggccgcccaaaagtgttcgac
agggatgccgcgcttgataaggccatgaaattgttctggcaacacggttatgaagcgact
tctcttgcggacctcgtcgaagcgaccggagccaaagcgcccacgctatacgcggaattt
accaacaaagaggggttatttcgtgccgttctcgaccgctatatcgatcgttttgccgct
aagcatgaagcacagctgttttgtgaagagaaaagcgtggagtctgcgctggctgactat
tttgctgccatcgccaactgctttaccagcaaagacaccccggcaggctgcttcatgatc
aacaactgcaccaccctctccccagattcaggagatatcgccaatacgttgaaatcacgc
catgcgatgcaagagcgcactttgcagcagtttttatgtcaacgacaagcgcgcggggaa
atcccgccccactgtgacgtgacacatctggcagaattccttaattgtattattcagggg
atgtcgatcagcgcacgcgaaggtgcatcgctggaaaaactgatgcagattgccggaacg
actttgcgtttatggcccgaactggtgaaataa

DBGET integrated database retrieval system